Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.609 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.724 productos)
- Anticuerpos del metabolismo(278 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
KLHL2 antibody
<p>KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN</p>ETV1 antibody
<p>ETV1 antibody was raised in Mouse using a purified recombinant fragment of ETV1(aa1-191) expressed in E. coli as the immunogen.</p>GGH antibody
<p>The GGH antibody is a monoclonal antibody that specifically targets histone H3, an important protein involved in gene regulation and chromatin structure. This antibody recognizes and binds to histone H3 in various biological samples, including human serum and nuclear extracts. It can be used for a wide range of applications, such as immunohistochemistry, western blotting, and ELISA. The GGH antibody is highly specific and sensitive, making it a valuable tool for researchers studying epigenetics, gene expression, and chromatin remodeling. With its high affinity and selectivity, this antibody offers reliable and reproducible results for both basic research and clinical diagnostics.</p>GJB4 antibody
<p>GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL</p>CALCOCO2 antibody
<p>CALCOCO2 antibody was raised in Rabbit using Human CALCOCO2 as the immunogen</p>GALNS antibody
<p>The GALNS antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets and binds to a specific antigen, allowing for precise detection and analysis of various biological processes. In addition to its use as a diagnostic tool, the GALNS antibody has also been found to have therapeutic potential.</p>PRMT2 antibody
<p>PRMT2 antibody was raised in mouse using recombinant Human Protein Arginine Methyltransferase 2</p>CDK4 antibody
<p>Cyclin Dependent Kinase 4 antibody was raised in mouse using human recombinant full-length cdk4 polypeptide as the immunogen.</p>IGJ antibody
<p>The IGJ antibody is a highly specialized monoclonal antibody that targets the histidine region of the insulin growth factor (IGF) receptor. This antibody has been extensively studied and has shown great potential in various areas of life sciences research.</p>Mycoplasma pneumoniae antibody
<p>Mycoplasma pneumoniae antibody is a specialized protein that targets the circumsporozoite protein of the bacteria. This antibody has been shown to have anti-glial fibrillary acidic properties, acting as a growth factor and neurotrophic agent. It is a monoclonal antibody that specifically neutralizes Mycoplasma pneumoniae and has been extensively studied in the field of Life Sciences. The antibody has also been found to exhibit tyrosine phosphatase activity and has potential neuroprotective effects. With its unique properties, this Mycoplasma pneumoniae antibody offers promising applications in various research areas and can be a valuable tool for scientists studying antibodies and their functions.</p>C4ORF20 antibody
<p>C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD</p>BP1 antibody
<p>The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.</p>Monkey RBC antibody (Texas Red)
<p>Monkey RBC antibody (Texas Red) was raised in rabbit using monkey erythrocytes as the immunogen.</p>Serotonin receptor 3B antibody
<p>Serotonin receptor 3B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT</p>SR140 antibody
<p>SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF</p>RAB3IP antibody
<p>RAB3IP antibody was raised using a synthetic peptide corresponding to a region with amino acids SPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPV</p>MUC2 antibody
<p>The MUC2 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets the MUC2 protein, which plays a crucial role in maintaining the integrity of the mucosal barrier in various tissues. This antibody can be used for research purposes to study the function and regulation of MUC2 in different biological processes.</p>JAK2 antibody
<p>The JAK2 antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets and binds to the Janus kinase 2 (JAK2) protein, which plays a crucial role in various cellular processes. The JAK2 antibody has been extensively studied for its ability to inhibit the activation of JAK2 and downstream signaling pathways, including the β-catenin pathway. This inhibition can have significant implications in liver microsomes, collagen synthesis, growth factor signaling, oncostatin M-induced gene expression, calmodulin-dependent kinase activity, and more.</p>TRIM28 antibody
<p>The TRIM28 antibody is a polyclonal antibody that belongs to the class of antibodies used in life sciences research. It specifically targets and neutralizes the TRIM28 protein, which is involved in various cellular processes. This antibody has been shown to be effective in detecting and quantifying TRIM28 in human serum samples. It can also be used to study the role of TRIM28 in different cell types and its interaction with other proteins, such as histidine or chemokines. The TRIM28 antibody is a valuable tool for researchers working on understanding the function of this protein and its potential implications in various diseases.</p>CASQ2 antibody
<p>CASQ2 antibody was raised in mouse using recombinant human CASQ2 (20-399aa) purified from E. coli as the immunogen.</p>CLDN6 antibody
<p>The CLDN6 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets the epidermal growth factor and plays a crucial role in various biological processes. This polyclonal antibody has been extensively tested and proven to be effective in detecting CLDN6 protein expression.</p>LYVE1 antibody
<p>The LYVE1 antibody is a monoclonal antibody that specifically targets estrogen receptors. It has been shown to be highly effective in binding to activated estrogen receptors and blocking their activity. This antibody also has the ability to inhibit the production of interleukin-6, a pro-inflammatory cytokine that plays a role in various diseases.</p>VRK2 antibody
<p>The VRK2 antibody is a highly specialized bioassay tool used in Life Sciences research. This antibody is designed to specifically target and bind to VRK2, a growth factor involved in various cellular processes. It has been extensively tested and validated for its efficacy in detecting VRK2 in samples such as blood plasma or cell lysates.</p>IGF2BP2 antibody
<p>The IGF2BP2 antibody is a highly specialized antibody that targets the transferrin receptor in the nucleus of cells. This antibody is widely used in Life Sciences research to study various cellular processes, including exocytosis, cell signaling, and protein synthesis. The IGF2BP2 antibody specifically binds to the antigen on the cell surface and facilitates the internalization of transferrin into the cell. This process is crucial for proper iron metabolism and cellular homeostasis. Additionally, this monoclonal antibody has been shown to have antimicrobial properties against certain bacteria, such as those expressing alpha-gal epitopes. Its unique mechanism of action involves targeting bacterial phosphatases and inhibiting their activity, leading to impaired bacterial growth. With its high specificity and potency, the IGF2BP2 antibody is an invaluable tool for researchers in various fields of study.</p>THG1L antibody
<p>THG1L antibody was raised using a synthetic peptide corresponding to a region with amino acids DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY</p>Goat anti Armenian Hamster IgG (H + L) (FITC)
<p>Goat anti-armenian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.</p>SSX1 antibody
<p>The SSX1 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It targets and binds to the activated form of SSX1, a methyl transferase enzyme involved in various cellular processes. This antibody is designed to specifically recognize and bind to the phosphorylation site on SSX1, allowing for precise detection and analysis.</p>Arginase 1 antibody
<p>The Arginase 1 antibody is a powerful tool in the field of life sciences. It is a polyclonal antibody that specifically targets arginase, an enzyme involved in the metabolism of arginine. This antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA.</p>CCR5 antibody
<p>The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.</p>
