Anticuerpos primarios

<p>PAOX antibody was raised using a synthetic peptide corresponding to a region with amino acids HSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLA</p>

<p>The RRM1 antibody is a monoclonal antibody that specifically targets the alpha-msh growth factor receptor. This antibody has high affinity and specificity for the receptor, allowing it to effectively bind and block its activity. It is commonly used in life sciences research to study the function and signaling pathways of the alpha-msh growth factor.</p>

<p>MLH1 antibody was raised in Mouse using a purified recombinant fragment of MLH1 (aa381-483) expressed in E. coli as the immunogen.</p>

<p>The BRAF antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the BRAF protein, which plays a crucial role in cell growth and division. This antibody has been extensively studied for its potential neuroprotective effects and its ability to inhibit the growth of cancer cells.</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified keratin K20 from human intestinal mucosa as the immunogen.</p>

<p>The LOX antibody is a monoclonal antibody that targets the LOX protein, which plays a crucial role in various biological processes. This antibody can be used in Life Sciences research to study the function and expression of LOX. It is designed to specifically bind to LOX and can be used in techniques such as immunohistochemistry and Western blotting.</p>

<p>RANKL antibody was raised in mouse using highly pure recombinant human sRANK ligand as the immunogen.</p>

<p>Rabbit polyclonal SULT1C2 antibody</p>

<p>Rabbit polyclonal RPS25 antibody (biotin)</p>

<p>GBP2 antibody was raised in Rabbit using Human GBP2 as the immunogen</p>

<p>Rabbit polyclonal PCDHB12 antibody</p>

<p>Purified Rabbit polyclonal USP35 antibody</p>

<p>The AP2M1 antibody is a highly specialized monoclonal antibody that targets the growth factor receptor AP2M1. It is colloidal in nature and has been specifically designed to bind to chemokines and antibodies, making it an essential tool in various life sciences research applications. The AP2M1 antibody has shown significant efficacy in studies involving breast cancer cell line MCF-7, where it demonstrated its ability to inhibit fatty acid uptake and disrupt intracellular trafficking of epidermal growth factor receptors. Additionally, this monoclonal antibody has been found to have potent anti-collagen activity and can be used for targeted therapy against diseases such as rheumatoid arthritis or fibrosis. Its activation potential on mesenchymal stem cells further highlights its versatility and potential applications in regenerative medicine.</p>

<p>Rabbit polyclonal T4S1 antibody</p>

<p>Purified Polyclonal RIMKLA antibody</p>

<p>Rabbit polyclonal Rad51D antibody</p>

<p>NAT10 antibody was raised in Rabbit using Human NAT10 as the immunogen</p>

<p>Cytokeratin 13 antibody was raised in mouse using cytokeratin 13 purified from human esophagus as the immunogen.</p>

<p>Purified Polyclonal Gamma enolase antibody</p>

<p>GTPBP2 antibody was raised in Rabbit using Human GTPBP2 as the immunogen</p>

<p>KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool for researchers in the field of Life Sciences. This monoclonal antibody is specifically designed to neutralize the activity of Tyrosine Hydroxylase, an enzyme involved in the synthesis of neurotransmitters like dopamine and norepinephrine. By targeting and inhibiting Tyrosine Hydroxylase, this antibody allows researchers to study the role of this enzyme in various biological processes.</p>

<p>The MMP7 antibody is a highly specialized monoclonal antibody that targets matrix metalloproteinase 7 (MMP7), an enzyme involved in the breakdown of extracellular matrix components. This antibody is widely used in Life Sciences research to study various cellular processes, including cell migration, tissue remodeling, and cancer progression.</p>

<p>DNALI1 antibody was raised using the C terminal of DNALI1 corresponding to a region with amino acids ALQAEQGKSDMERKIAELETEKRDLERQVNEQKAKCEATEKRESERRQVE</p>

<p>Purified Polyclonal GAD1/2 antibody</p>

<p>Influenza A antibody (H1N1) (FITC) was raised in goat using Influenza A, strain USSR (H1N1) as the immunogen.</p>

<p>EI24 antibody was raised in Rabbit using Human EI24 as the immunogen</p>

<p>Purified Rabbit polyclonal MYB28 antibody</p>

<p>Armenian Hamster monoclonal CD29 antibody (biotin)</p>

<p>GRIPAP1 antibody was raised in Rabbit using Human GRIPAP1 as the immunogen</p>

<p>Akt, or Protein Kinase B (PKB), is a crucial signaling protein that regulates essential cellular functions, including growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, a key signaling pathway activated by growth factors and hormones like insulin to support cell survival and growth. Upon activation, Akt moves to the cell membrane, where it is phosphorylated by kinases such as PDK1, achieving full activation. Once active, Akt interacts with downstream pathways to prevent apoptosis, stimulate cell growth via the mTOR pathway, and boost glucose metabolism—vital for effective insulin response.In diseases like cancer and diabetes, Akt's role is especially important. Cancer often involves dysregulated Akt signaling due to mutations in pathway components like PI3K, PTEN, or Akt itself, leading to enhanced cell survival, unchecked growth, and treatment resistance. In diabetes, insulin resistance impairs Akt pathway function, reducing glucose uptake and resulting in high blood glucose levels. Given Akt's regulatory role in cell growth and metabolism, it is a primary focus in therapeutic research for conditions where its function is disrupted.</p>

<p>Affinity purified Rabbit polyclonal GULP1 antibody</p>

<p>Rabbit polyclonal GAB2 antibody (Tyr452)</p>

<p>EIF2S2 antibody was raised using the N terminal of EIF2S2 corresponding to a region with amino acids TQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKK</p>

<p>PYK2 antibody was raised in Mouse using a purified recombinant fragment of PYK2(aa815-997) expressed in E. coli as the immunogen.</p>

<p>Affinity purified Rabbit polyclonal UBE2B antibody</p>

<p>ATP2C1 antibody was raised in Rabbit using Human ATP2C1 as the immunogen</p>

<p>The KLK6 antibody is an extracellular antibody that is primarily used in neuronal cultures for research purposes. This antibody specifically targets the phosphorylation site of KLK6, a protein that plays a crucial role in various biological processes within the Life Sciences field. KLK6 is known to interact with growth factors and synaptic proteins, and its activity has been linked to exocytosis and vesicular trafficking. By targeting KLK6, this polyclonal antibody can help researchers gain insights into the mechanisms of inhibitory neurotransmission and the regulation of protein isoforms. Additionally, it can be used to study the involvement of KLK6 in protein kinase signaling pathways.</p>

<p>The VAV1 antibody is a highly reactive and ultrasensitive detection tool used in Life Sciences research. This monoclonal antibody is specifically designed to target VAV1, a protein involved in various cellular processes such as growth factor signaling and immune response. The VAV1 antibody utilizes streptavidin-coated microspheres for efficient immobilization and detection, ensuring accurate and reliable results. Whether used in intraocular studies or on an electrode platform, this antibody provides exceptional sensitivity and specificity. Its versatility makes it an indispensable tool for researchers working with VAV1 and related pathways. Trust the VAV1 antibody to deliver precise and reproducible data in your experiments.</p>

<p>The JNK1 antibody is a highly specific monoclonal antibody that targets the JNK1 protein. It has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA. This antibody has shown excellent performance in detecting JNK1 expression in human hepatocytes and other cell types.</p>

<p>ARL8B antibody was raised using the middle region of ARL8B corresponding to a region with amino acids DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL</p>

<p>Purified Rabbit polyclonal MYOM1 antibody</p>

<p>Nidogen/Enactin Monoclonal Antibody</p>

<p>The POSTN antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and inhibitory factors in Life Sciences. This antibody is available in both polyclonal and monoclonal forms, offering versatility in research applications.</p>

<p>CD4 antibody (Azide Free) was raised in rat using cloned murine CTL line V41 as the immunogen.</p>

<p>Keratin K18 antibody was raised in Mouse using a purified recombinant fragment of human Keratin K18 (aa391-483) expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal PVRL1 antibody</p>

<p>Mouse monoclonal Complement C5b9 antibody (Biotin)</p>

<p>Rabbit polyclonal RFFL antibody</p>

<p>Mouse monoclonal VSIG2 antibody</p>