Anticuerpos primarios
Los anticuerpos primarios son inmunoglobulinas que se unen específicamente a un antígeno de interés, permitiendo la detección y cuantificación de proteínas, péptidos u otras biomoléculas. Estos anticuerpos son herramientas fundamentales en una amplia gama de aplicaciones, como el Western blot, la inmunohistoquímica y el ELISA. En CymitQuimica, ofrecemos una extensa selección de anticuerpos primarios de alta calidad que brindan especificidad y sensibilidad para diversas necesidades de investigación, incluidas las áreas de cáncer, inmunología y biología celular.
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.609 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(746 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.691 productos)
- Anticuerpos del metabolismo(278 productos)
- Anticuerpos de microbiología(736 productos)
- Transducción de señales(2.710 productos)
- Etiquetas y marcadores celulares(33 productos)
Mostrar 1 subcategorías más
Se han encontrado 69953 productos de "Anticuerpos primarios"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
GADD45B antibody
<p>GADD45B antibody was raised using the middle region of GADD45B corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW</p>Pureza:Min. 95%WNT5A antibody
<p>WNT5A antibody was raised using the middle region of WNT5A corresponding to a region with amino acids GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT</p>Pureza:Min. 95%MAX antibody
<p>MAX antibody was raised in rabbit using the n terminal of MAX as the immunogen</p>Pureza:Min. 95%CHIC2 antibody
<p>CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE</p>Pureza:Min. 95%NP1 antibody
<p>NP1 antibody was raised in goat using highly pure recombinant human NP-1 as the immunogen.</p>Pureza:Min. 95%GNAI2 antibody
<p>GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDL</p>Pureza:Min. 95%Persephin antibody
<p>Persephin antibody was raised in rabbit using highly pure recombinant human persephin as the immunogen.</p>Pureza:Min. 95%Bend6 antibody
<p>Bend6 antibody was raised in rabbit using the C terminal of Bend6 as the immunogen</p>Pureza:Min. 95%ZNF529 antibody
<p>ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen</p>Pureza:Min. 95%SLC25A28 antibody
<p>SLC25A28 antibody was raised using the middle region of SLC25A28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH</p>Pureza:Min. 95%FKBP4 antibody
<p>FKBP4 antibody was raised in rabbit using the C terminal of FKBP4 as the immunogen</p>Pureza:Min. 95%ACSL1 antibody
<p>ACSL1 antibody was raised using the C terminal of ACSL1 corresponding to a region with amino acids GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG</p>Pureza:Min. 95%Complement C5 antibody
<p>Complement C5 antibody was raised against Human Complement C5.</p>Pureza:Min. 95%WDFY3 antibody
<p>WDFY3 antibody was raised in rabbit using the middle region of WDFY3 as the immunogen</p>Pureza:Min. 95%POLB antibody
<p>POLB antibody was raised using a synthetic peptide corresponding to a region with amino acids GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML</p>Pureza:Min. 95%TMEM135 antibody
<p>TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC</p>Pureza:Min. 95%Goat anti Human IgM (mu Chain) (Alk Phos)
<p>Please enquire for more information about Goat anti Human IgM (mu Chain) (Alk Phos) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Trim3 antibody
<p>Trim3 antibody was raised in rabbit using the N terminal of Trim3 as the immunogen</p>Pureza:Min. 95%OSBPL11 antibody
<p>OSBPL11 antibody was raised in rabbit using the C terminal of OSBPL11 as the immunogen</p>Pureza:Min. 95%PCDHGA4 antibody
<p>PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT</p>Pureza:Min. 95%OR2M5 antibody
<p>OR2M5 antibody was raised in rabbit using the C terminal of OR2M5 as the immunogen</p>Pureza:Min. 95%UGT1A5 antibody
<p>UGT1A5 antibody was raised in rabbit using the N terminal of UGT1A5 as the immunogen</p>Pureza:Min. 95%NRIP3 antibody
<p>NRIP3 antibody was raised in rabbit using the middle region of NRIP3 as the immunogen</p>Pureza:Min. 95%NPFF2 antibody
<p>NPFF2 antibody was raised in rabbit using human NPFF2 protein as the immunogen.</p>Pureza:Min. 95%LOC391764 antibody
<p>LOC391764 antibody was raised in rabbit using the middle region of LOC391764 as the immunogen</p>Pureza:Min. 95%Morf4l1 antibody
<p>Morf4l1 antibody was raised in rabbit using the middle region of Morf4l1 as the immunogen</p>Pureza:Min. 95%SLCO3A1 antibody
<p>SLCO3A1 antibody was raised using the middle region of SLCO3A1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL</p>Pureza:Min. 95%SERPINF2 antibody
<p>SERPINF2 antibody was raised in rabbit using the N terminal of SERPINF2 as the immunogen</p>Pureza:Min. 95%HCN3 antibody
<p>HCN3 antibody was raised using the middle region of HCN3 corresponding to a region with amino acids LQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV</p>Pureza:Min. 95%DMRTA2 antibody
<p>DMRTA2 antibody was raised in rabbit using the C terminal of DMRTA2 as the immunogen</p>Pureza:Min. 95%Tyrosine Hydroxylase antibody
<p>The Tyrosine Hydroxylase antibody is a powerful tool used in the field of Life Sciences. It plays a crucial role in various biological processes, including growth factor signaling, phosphatase activity, and binding to nuclear proteins. This monoclonal antibody specifically targets tyrosine hydroxylase, an enzyme involved in the synthesis of important neurotransmitters such as dopamine.</p>Pureza:Min. 95%TMEM166 antibody
<p>TMEM166 antibody was raised in rabbit using the middle region of TMEM166 as the immunogen</p>Pureza:Min. 95%COL4A6 antibody
<p>COL4A6 antibody was raised in rabbit using the middle region of COL4A6 as the immunogen</p>Pureza:Min. 95%NUDC antibody
<p>NUDC antibody was raised using a synthetic peptide corresponding to a region with amino acids DAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYR</p>Pureza:Min. 95%C14ORF101 antibody
<p>C14ORF101 antibody was raised in rabbit using the N terminal of C14ORF101 as the immunogen</p>Pureza:Min. 95%Ambp antibody
<p>Ambp antibody was raised in rabbit using the N terminal of Ambp as the immunogen</p>Pureza:Min. 95%TNF Receptor Type I antibody
<p>TNF receptor type I antibody was raised in rabbit using highly pure recombinant human sTNF-receptor as the immunogen.</p>Pureza:Min. 95%TMEM38A antibody
<p>TMEM38A antibody was raised using the N terminal of TMEM38A corresponding to a region with amino acids GEPLIDYFSNNSSILLASAVWYLIFFCPLDLFYKCVCFLPVKLIFVAMKE</p>Pureza:Min. 95%ZNF131 antibody
<p>ZNF131 antibody was raised in rabbit using the N terminal of ZNF131 as the immunogen</p>Pureza:Min. 95%TRPV4 antibody
<p>TRPV4 antibody was raised using the middle region of TRPV4 corresponding to a region with amino acids RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR</p>Pureza:Min. 95%GABRA4 antibody
<p>GABRA4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSAKKVPAIALSAGVSFALLRFLCLAVCLNESPGQNQKEEKLCTENFTR</p>Pureza:Min. 95%TRIM34 antibody
<p>TRIM34 antibody was raised in rabbit using the N terminal of TRIM34 as the immunogen</p>Pureza:Min. 95%RFC3 antibody
<p>RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF</p>Pureza:Min. 95%NAT8B antibody
<p>NAT8B antibody was raised using a synthetic peptide corresponding to a region with amino acids SCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKA</p>Pureza:Min. 95%FKBP2 antibody
<p>FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV</p>Pureza:Min. 95%Afamin antibody
<p>Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR</p>Pureza:Min. 95%FLJ37300 antibody
<p>FLJ37300 antibody was raised using the N terminal Of Flj37300 corresponding to a region with amino acids EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE</p>Pureza:Min. 95%SLC9A9 antibody
<p>SLC9A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids INYQEQASSPCSPPARLGLDQKASPQTPGKENIYEGDLGLGGYELKLEQT</p>Pureza:Min. 95%
