Anticuerpos primarios

<p>Affinity purified Rabbit polyclonal Ataxin 3 antibody</p>

<p>The SMAD4 antibody is a highly effective inhibitor that targets the histidine-rich region of the human serum. It specifically blocks the activity of growth factors, preventing their binding to receptors and subsequent signaling pathways. This monoclonal antibody has been extensively studied and proven to be nephrotoxic in various experimental models. Additionally, it has shown promising results in inhibiting the epidermal growth factor pathway, making it a potential therapeutic option for diseases associated with its overactivation.</p>

<p>The Chk1 antibody is a powerful tool in the field of Life Sciences. It is an interferon-gamma (IFN-γ) antibody that exhibits cytotoxic effects on targeted cells. This polyclonal antibody specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. The Chk1 antibody can be used for various applications, including immunohistochemistry, western blotting, and ELISA assays.</p>

<p>Mouse monoclonal KHK antibody</p>

<p>ARF1 antibody was raised in Rabbit using Human ARF1 as the immunogen</p>

<p>CNR1 antibody was raised in Rabbit using Human CNR1 as the immunogen</p>

<p>Rabbit polyclonal WDR77 antibody</p>

<p>The CD90 antibody is a highly specific polyclonal antibody that targets the CD90 antigen, also known as Thy-1. It is commonly used in research and diagnostic applications to detect and analyze human proteins. This antibody has been extensively validated for its high affinity and specificity in various assays, including immunohistochemistry, flow cytometry, and western blotting.</p>

<p>Antithrombin III antibody (HRP) was raised in sheep using human antithrombin purified from plasma as the immunogen.</p>

<p>The SOS1 antibody is a highly specialized antibody that targets the SOS1 protein, an oncogene homolog involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>

<p>SLC19A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP</p>

<p>GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR</p>

<p>Purified Polyclonal DMPK antibody</p>

<p>The Glycogen Synthase antibody is a powerful tool in the field of Life Sciences. It is a Polyclonal Antibody that specifically targets glycogen synthase, an enzyme involved in glycogen synthesis. This antibody has been extensively studied and validated for its high specificity and sensitivity.</p>

<p>Affinity purified Rabbit polyclonal Leucine zipper protein 1 antibody</p>

<p>The GPR116 antibody is a highly specialized monoclonal antibody that targets the G-protein coupled receptor 116. This antibody has been extensively used in various assays and research studies in the field of Life Sciences. It specifically inhibits the activity of GPR116, which is a family kinase inhibitor involved in regulating dopamine signaling pathways.</p>

<p>Mouse monoclonal Exendin 4 antibody (Biotin)</p>

<p>Rabbit polyclonal CSRP1 antibody (FITC)</p>

<p>CD37 antibody was raised in Mouse using a purified recombinant fragment of CD37 expressed in E. coli as the immunogen.</p>

<p>Rat monoclonal CD244.2 antibody (PE)</p>

<p>Rabbit polyclonal HLAB antibody</p>

<p>RHOJ antibody was raised using the middle region of RHOJ corresponding to a region with amino acids LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK</p>

<p>Rabbit polyclonal Kinase E28 antibody</p>

<p>The BACH1 antibody is a polyclonal antibody that targets the nuclear protein BACH1. This antibody is widely used in life sciences research to study the role of BACH1 in various cellular processes, including the regulation of neurotrophic factors and TNF-α. It has been shown to have inhibitory properties, immobilizing BACH1 and preventing its interaction with other proteins. Additionally, this antibody has natriuretic and neutralizing effects on certain antibodies, such as anti-CD33 antibody and TGF-β1. Researchers rely on the specificity and effectiveness of the BACH1 antibody to gain insights into the molecular mechanisms underlying various biological processes.</p>

<p>CEP55 antibody was raised using the middle region of CEP55 corresponding to a region with amino acids TLDFENEKLDRQHVQHQLHVILKELRKARNQITQLESLKQLHEFAITEPL</p>

<p>TAF9L antibody was raised in mouse using recombinant Human Taf9B Rna Polymerase Ii, Tata Box Binding Protein, (Tbp)-Associated Factor, 31Kda (Taf9B)</p>

<p>BCL7A antibody was raised using the middle region of BCL7A corresponding to a region with amino acids QENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGKEHPGAEDASDEQNSQS</p>

<p>Rabbit polyclonal IBP7 antibody</p>

<p>DDX21 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEET</p>

<p>Rabbit polyclonal KLF10/11 antibody</p>

<p>The IL13 antibody is a highly specialized molecular docking and immobilization agent. It is designed to target and bind to the IL13 hormone peptide, effectively neutralizing its effects. This monoclonal antibody has been extensively tested and proven to be effective in various research studies within the Life Sciences field.</p>

<p>Mouse monoclonal BIRC2 antibody</p>

<p>Purified Polyclonal Cerebellin 4 antibody</p>

<p>Rabbit polyclonal ATP5D antibody</p>

<p>ARHGEF16 antibody was raised in Rabbit using Human ARHGEF16 as the immunogen</p>

<p>The RAE1 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to the racemase enzyme, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in immobilizing the racemase enzyme, thereby inhibiting its activity.</p>

<p>Mouse monoclonal NDUFA7 antibody</p>

<p>Rabbit polyclonal ARFGAP3 antibody</p>

<p>The S6K1 antibody is a highly specific monoclonal antibody that can be used in various applications within the Life Sciences field. This antibody specifically targets and binds to the S6K1 protein, which plays a crucial role in cell growth, proliferation, and survival.</p>

<p>The VASP antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that targets the vasodilator-stimulated phosphoprotein (VASP), which plays a crucial role in cell signaling and cytoskeleton organization. This antibody can be used for various applications, including research on epidermal growth factor signaling pathways, cytotoxicity assays, and detection of VASP expression in different tissues and cell types.</p>

<p>The RNF125 antibody is a monoclonal antibody that specifically targets the TRPV4 protein. TRPV4 is a member of the transient receptor potential (TRP) family and plays a crucial role in various physiological processes. This antibody is designed to neutralize the activity of TRPV4, making it an essential tool for researchers studying TRPV4-related functions.</p>

<p>RANTES antibody was raised in mouse using highly pure human RANTES as the immunogen.</p>

<p>The SCAR antibody is a highly specific autoantibody that functions as an inhibitor of tyrosine. It is designed to target and block the activity of cortisol, a hormone involved in various physiological processes. By binding to cortisol, the SCAR antibody effectively reduces its concentration in the body. This low density cortisol has been shown to have therapeutic potential in assays and has been used as a medicament in the field of Life Sciences. Additionally, the SCAR antibody has demonstrated its ability to interact with other proteins such as vitronectin and androgen receptors. With its activated state, this antibody offers promising applications in research and clinical settings. For those seeking targeted therapies or investigating novel treatment options, the SCAR antibody provides a valuable tool for studying cortisol-related pathways and developing innovative approaches in healthcare.</p>

<p>The mGLUR5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as an inhibitor, targeting the androgen receptor and exerting cytotoxic effects on specific cells. This antibody also has the ability to neutralize certain growth factors, interferons, hepatocyte growth factors, and chemokines. Additionally, it exhibits antiviral properties by targeting glycoproteins involved in viral replication. The mGLUR5 antibody is a versatile tool that can be utilized in various research applications, including multidrug resistance studies and electrode-based assays. Its high specificity and potency make it an invaluable asset for scientists working in diverse fields of study.</p>

<p>KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS</p>

<p>AKR1CL2 antibody was raised in Rabbit using Human AKR1CL2 as the immunogen</p>

<p>Rabbit polyclonal RABL3 antibody</p>

<p>CD3e antibody (Azide free) was raised in rat using CD3e as the immunogen.</p>

<p>NDUFS1 antibody was raised in Rabbit using Human NDUFS1 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Centaurin alpha 1 antibody</p>