Anticuerpos primarios

<p>MRI1 antibody was raised in Rabbit using Human MRI1 as the immunogen</p>

<p>MRPL38 antibody was raised in Rabbit using Human MRPL38 as the immunogen</p>

<p>Mouse monoclonal DENV2 ED2 antibody</p>

<p>SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids PVIVEPLEQLDDEDGLPEKLAQKNPMYQKERETPPRFAQHGTFEYEYSQR</p>

<p>PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM</p>

<p>Rabbit polyclonal SENP3 antibody</p>

<p>The PPP1R15A antibody is a powerful tool used in various research applications. This antibody specifically targets the PPP1R15A protein, which plays a crucial role in cellular responses to stress and the regulation of protein synthesis.</p>

<p>GPKOW antibody was raised in Rabbit using Human GPKOW as the immunogen</p>

<p>Rabbit polyclonal CD45 antibody (Ser1007)</p>

<p>Purified Polyclonal RBBP6 antibody</p>

<p>LRRC8C antibody was raised in Rabbit using Human LRRC8C as the immunogen</p>

<p>Rabbit polyclonal CaMK2 antibody (Thr286)</p>

<p>GTDC1 antibody was raised using the N terminal of GTDC1 corresponding to a region with amino acids CQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKFMKLIPDHRPK</p>

<p>ASXL1 antibody was raised in mouse using recombinant Human Additional Sex Combs Like 1 (Drosophila) (Asxl1)</p>

<p>The Cytokeratin 18 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It plays a crucial role in various research applications, particularly in the study of adipocytes and endothelial growth. This antibody has been extensively tested and proven to be effective in neutralizing specific targets such as caspase-9, which is involved in apoptosis.</p>

<p>Purified Polyclonal KA2 antibody</p>

<p>Purified Polyclonal Caspase 2 p18 antibody</p>

<p>TARP antibody was raised in rabbit using the N terminal of TARP as the immunogen</p>

<p>EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>The GST Tag antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to the glutathione S-transferase (GST) tag, a commonly used protein fusion tag. This antibody is invaluable for detecting and quantifying GST-tagged proteins in various applications.</p>

<p>Mouse monoclonal PFDN6 antibody</p>

<p>Mouse monoclonal SERPINE2 antibody</p>

<p>Rabbit polyclonal VPS8 antibody</p>

<p>The LKB1 antibody is a polyclonal antibody that specifically targets the growth factor LKB1. It has a high affinity for LKB1 and can be used in various research applications. This antibody has been shown to bind to serum albumin, making it suitable for use in immunohistochemistry and immunofluorescence assays. Additionally, the LKB1 antibody can detect glutamate, actin, and cytotoxic molecules in samples, making it a versatile tool for studying cellular processes. It is also available as a monoclonal antibody for more specific applications. The LKB1 antibody is activated by sulphates present in human serum, allowing for accurate detection of LKB1 levels in biological samples. In the field of Life Sciences, this antibody is commonly used to study autoantibodies and phosphatase activity. Its ability to label actin filaments makes it particularly useful for visualizing cytoskeletal structures.</p>

<p>The MIOX antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets alpha-fetoprotein, an important antigen involved in various biological processes. This antibody is highly specific and has been extensively validated for its accuracy and reliability.</p>

<p>The ENO2 antibody is a highly specialized immunosuppressant that targets protein-protein interactions. It specifically binds to ENO2 dimers, which play a crucial role in various cellular processes. This monoclonal antibody has been extensively studied and characterized for its ability to inhibit the activity of ENO2, thereby preventing its interaction with other molecules.</p>

<p>PSG1 antibody was raised using the N terminal of PSG1 corresponding to a region with amino acids SGRETAYSNASLLIQNVTREDAGSYTLHIIKGDDGTRGVTGRFTFTLHLE</p>

<p>Rabbit polyclonal Bcl6 antibody (Ser333)</p>

<p>BGN antibody was raised in Rabbit using Human BGN as the immunogen</p>

<p>MUC1 antibody was raised in mouse using purified native MUC1 as the immunogen.</p>

<p>The ST6GAL1 antibody is a polyclonal antibody commonly used in the field of Life Sciences. It is specifically designed to target and bind to the ST6GAL1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Rabbit Polyclonal GATA1 antibody (Ser142)</p>

<p>Rabbit polyclonal RBL2 antibody</p>

<p>FXR1 antibody was raised in Rabbit using Human FXR1 as the immunogen</p>

<p>Rabbit polyclonal USH1C antibody</p>

<p>Mouse monoclonal MAPRE2 antibody</p>

<p>Ret antibody was raised in Mouse using a purified recombinant fragment of Ret(aa896-1063) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal TIMM17A antibody</p>

<p>The HEV ORF2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the ORF2 protein of the hepatitis E virus (HEV), which is responsible for viral replication and assembly. This antibody can be used for various applications, such as immunohistochemistry, Western blotting, and ELISA assays.</p>

<p>ITM2A antibody was raised in Rabbit using Human ITM2A as the immunogen</p>

<p>IFITM2 antibody was raised in Rabbit using Human IFITM2 as the immunogen</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is particularly effective in treating tuberculosis infections due to its strong bactericidal activity. This compound inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Canine parvovirus (CPV) is a highly contagious viral infection that affects dogs, especially puppies and young dogs. The virus belongs to the Parvoviridae family and is closely related to feline panleukopenia virus (FPV), which affects cats.;This Monoclonal anti-Canine Parvovirus antibody is suitable for ELISA and LFD applications. Suggest using as capture antibody in LFD format.</p>

<p>CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW</p>

<p>TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED</p>

<p>ARSA antibody was raised using the middle region of ARSA corresponding to a region with amino acids KQLQLLKAQLDAAVTFGPSQVARGEDPALQICCHPGCTPRPACCHCPDPH</p>

<p>OSTF1 antibody was raised in rabbit using the N terminal of OSTF1 as the immunogen</p>

<p>Integrin beta 3 antibody is a highly specialized antibody that targets and neutralizes the activity of TGF-β1 and IFN-gamma. This antibody has been extensively studied for its ability to bind to specific proteins involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, offering a wide range of options for researchers.</p>

<p>The TOMM20 antibody is a growth factor that plays a crucial role in various biological processes. It is an antibody specifically designed to target and bind to TOMM20, an essential protein involved in mitochondrial import. This antibody can be used for research purposes in the field of life sciences, particularly in the study of mitochondrial function and dynamics.</p>