Anticuerpos primarios

<p>Mouse monoclonal CD11c antibody (biotin)</p>

<p>The BIN3 antibody is a highly specialized monoclonal antibody that acts as a neutralizing agent. It is designed to target specific proteins, such as EGF-like antibodies and anti-CD20 monoclonal antibodies, in various assays used in the field of Life Sciences. This antibody has shown efficacy in neutralizing activated sclerostin and glucose-6-phosphate inhibitors, making it a valuable tool for researchers and scientists working on understanding and developing treatments for various diseases and conditions. With its precise targeting capabilities, the BIN3 antibody offers great potential for advancing scientific knowledge and improving patient outcomes.</p>

<p>Rabbit polyclonal OR2T10 antibody</p>

<p>EXO1 antibody was raised in Rabbit using Human EXO1 as the immunogen</p>

<p>Rabbit polyclonal SMYD4 antibody</p>

<p>Rabbit polyclonal Basigin antibody (FITC)</p>

<p>DHX38 antibody was raised in Rabbit using Human DHX38 as the immunogen</p>

<p>NDE1 antibody was raised in Rabbit using Human NDE1 as the immunogen</p>

<p>EPHB4 antibody was raised in Mouse using purified recombinant extracellular fragment of human EPHB4 fused with hIgGFc tag expressed in HEK293 cell line as the immunogen.</p>

<p>MCC antibody was raised in Rabbit using Human MCC as the immunogen</p>

<p>The CDK2 antibody is a monoclonal antibody that is widely used in Life Sciences research. It is specifically designed to target and bind to cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. This antibody has been extensively validated for use in various assays, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>Rabbit polyclonal PMF1 antibody</p>

<p>Rabbit polyclonal TPK1 antibody</p>

<p>Mouse monoclonal KIAA0495 antibody</p>

<p>Rabbit polyclonal CPNE9 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thereby preventing bacterial growth. It has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>C10orf30 antibody was raised using the N terminal of C10orf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR</p>

<p>The Somatostatin antibody is a protein that specifically targets and binds to somatostatin. It is a polyclonal antibody, meaning it is derived from multiple sources and can recognize different epitopes of the target protein. The antibody is produced through a process that involves the formation of disulfide bonds, ensuring its stability and functionality.</p>

<p>The TCTP antibody is a neuroprotective agent that targets tyrosine. It activates neurotrophic factors and works by binding to antibodies in Life Sciences. This antibody-drug complex can be used in electrode applications. The TCTP antibody is available in both polyclonal and monoclonal forms, allowing for specific targeting of alpha-fetoprotein and inhibitory factor. With its neurotrophic properties, the TCTP antibody has potential applications in the protection and regeneration of neurons, as well as in cardiomyocyte research.</p>

<p>Rabbit polyclonal RPC3 antibody</p>

<p>DHRS11 antibody was raised in Rabbit using Human DHRS11 as the immunogen</p>

<p>UBE2V1 antibody was raised in rabbit using the C terminal of UBE2V1 as the immunogen</p>

<p>Rabbit polyclonal PRKCSH antibody (HRP)</p>

<p>CTBP1 antibody was raised in Rabbit using Human CTBP1 as the immunogen</p>

<p>CD38 antibody was raised in rat using CD38 as the immunogen.</p>

<p>Purified Polyclonal LRP11 antibody</p>

<p>PAX3 antibody was raised in mouse using recombinant Human Paired Box Gene 3 (Waardenburg Syndrome 1) (Pax3)</p>

<p>Rabbit polyclonal TERF2IP antibody</p>

<p>Rabbit polyclonal PPGB antibody</p>

<p>The BTK antibody is a glycoprotein that specifically targets galectin-3, a biomolecule involved in various cellular processes. This monoclonal antibody is widely used in Life Sciences research and has shown promising results as a potential therapeutic agent for multidrug-resistant cancers. The BTK antibody binds to galectin-3, inhibiting its function and disrupting signaling pathways associated with cell growth and survival. Additionally, this antibody has been found to enhance the activity of interferon-gamma (IFN-gamma), an important immune regulator. By targeting galectin-3 and modulating IFN-gamma signaling, the BTK antibody holds great potential as a novel family kinase inhibitor and may contribute to the development of innovative treatments for cancer and other diseases involving aberrant protein expression.</p>

<p>Purified Polyclonal DHRS7 antibody</p>

<p>The RPA2 antibody is a monoclonal antibody that targets the chemokine receptor RPA2. It is commonly used in research and life sciences applications to study various cellular processes. This antibody specifically binds to RPA2, which plays a crucial role in cell migration, angiogenesis, and immune response. The RPA2 antibody can be used for immunohistochemistry, western blotting, flow cytometry, and other experimental techniques. With its high specificity and sensitivity, this antibody allows for accurate detection and analysis of RPA2 expression levels in different cell types and tissues. Whether you're studying helicobacter infection or investigating endothelial growth factors, the RPA2 antibody is an invaluable tool for your research needs. Trust this reliable monoclonal antibody to provide accurate results and help advance your scientific discoveries.</p>

<p>MMP3 antibody was raised in mouse using human pro-MMP-3 from the conditioned media of rheumatoid synovial fibroblasts as the immunogen.</p>

<p>Rabbit polyclonal GR antibody (Ser226)</p>

<p>Mouse monoclonal PYCR2 antibody</p>

<p>The S100 Beta antibody is a monoclonal antibody that specifically targets the S100 protein family. These proteins are involved in various cellular processes, including intracellular signaling and regulation of cell growth and differentiation. The S100 Beta antibody has been extensively studied in the field of life sciences and has shown promising results in research related to growth hormone receptors, growth factors, and hepatocyte growth. This antibody has also been found to interact with adipose tissue, tyrosine kinase receptors, apoa-i, collagen, and triglyceride lipase. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. With its high specificity and affinity for the target protein, the S100 Beta antibody is a valuable tool for researchers studying cellular processes and investigating potential therapeutic targets. Its use in research can lead to a better understanding of diseases and help develop novel treatments in the future.</p>

<p>Mouse monoclonal DOK2 antibody</p>

<p>PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD</p>

<p>The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.</p>

<p>Mouse monoclonal Integrin alpha 6B antibody</p>

<p>Rabbit polyclonal HTR7 antibody</p>

<p>The ZNF786 antibody is a monoclonal antibody that exhibits cytotoxic properties and interacts with interferon-gamma (IFN-gamma). It specifically targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer. Additionally, it has shown promising results in targeting the circumsporozoite protein of the malaria parasite. The ZNF786 antibody is highly specific and exhibits strong binding affinity towards its target, making it a valuable tool for research and diagnostic purposes. With its ability to modulate nuclear signaling and growth factors, this antibody holds great potential for future therapeutic interventions.</p>

<p>Purified Polyclonal Serpin B7 antibody</p>

<p>TNRC6A antibody was raised using the N terminal of TNRC6A corresponding to a region with amino acids RELEAKATKDVERNLSRDLVQEEEQLMEEKKKKKDDKKKKEAAQKKATEQ</p>

<p>OSBPL9 antibody was raised using the N terminal of OSBPL9 corresponding to a region with amino acids HQTPTPNSTGSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADE</p>

<p>The CD9 antibody is a monoclonal antibody that belongs to the class of antibodies known as polyclonal antibodies. It specifically targets CD9, a protein that is involved in various cellular processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the growth of fibroin and natriuretic factors. Additionally, it has been found to have anti-VEGF activity, which makes it a potential candidate for anti-angiogenic therapy. The CD9 antibody also plays a role in hormone regulation and has been shown to modulate endothelial growth. In liver microsomes, this antibody acts as an inhibitor of caspase-9, thus preventing apoptosis. Furthermore, it has been found to interact with fatty acids and β-catenin, suggesting its involvement in lipid metabolism and cell signaling pathways. Overall, the CD9 antibody is a versatile tool with diverse applications in research and pharmaceutical development.</p>

<p>ApoBEC3F antibody was raised using the N terminal of APOBEC3F corresponding to a region with amino acids MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD</p>

<p>Norovirus antibody was raised in mouse using purified native norwalk virus, strain 8Flla as the immunogen.</p>

<p>CBR3 antibody was raised in Rabbit using Human CBR3 as the immunogen</p>

<p>IL19 antibody is a monoclonal antibody that targets interleukin-19 (IL-19), a protein involved in various inflammatory processes. IL-19 is known to play a role in the development of amyloid plaques, which are associated with Alzheimer's disease. This antibody specifically binds to IL-19 and inhibits its activity, potentially reducing inflammation and the formation of amyloid plaques. Additionally, IL19 antibody has been shown to inhibit the growth of cancer cells by targeting proteins such as mesothelin and E-cadherin. It may also have potential therapeutic applications in other diseases characterized by abnormal immune responses or inflammation. With its high specificity and efficacy, IL19 antibody is a valuable tool for researchers in the field of Life Sciences studying cytokine biology and developing novel therapies.</p>