Anticuerpos primarios

<p>The NNMT antibody is a highly effective medicament used in the field of Life Sciences. It is specifically designed to target and bind to the NNMT protein, enabling researchers to study its functions and interactions in various biological processes. This monoclonal antibody exhibits a strong antigen-antibody reaction, allowing for precise detection and analysis of NNMT in samples.</p>

<p>The PKC alpha antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to protein kinase C alpha (PKC alpha), an enzyme involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Rabbit polyclonal KAL1 antibody</p>

<p>Rabbit polyclonal PRNP antibody</p>

<p>IDH3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK</p>

<p>PRPF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRR</p>

<p>Rabbit polyclonal HNF4 alpha/gamma antibody</p>

<p>The Caspase 1 antibody is a powerful tool used in various assays and research studies in the field of Life Sciences. It is an inhibitor that specifically targets caspase 1, which is a protease involved in the activation of inflammatory cytokines. This antibody can be used to neutralize the activity of caspase 1 and study its role in different cellular processes.</p>

<p>GRAP antibody was raised in Rabbit using Human GRAP as the immunogen</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>KISS1R antibody was raised in Rabbit using Human KISS1R as the immunogen</p>

<p>DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID</p>

<p>The STAT5A antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the STAT5A protein. This protein plays a crucial role in cell signaling pathways and is involved in various biological processes, including cell growth, differentiation, and immune response.</p>

<p>Purified Polyclonal PECI antibody</p>

<p>The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.</p>

<p>NFKB2 antibody was raised in Rabbit using Human NFKB2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal BRE antibody</p>

<p>The Estrogen Receptor alpha antibody is a highly effective monoclonal antibody that specifically targets the estrogen receptor alpha (ERα) protein. This antibody plays a crucial role in various biological processes, including cell growth, differentiation, and development. It has been extensively used in research studies to investigate the role of ERα in different diseases and conditions.</p>

<p>The CD66e antibody is a highly specialized antibody that targets the carbonyl group of the HER2 protein. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications in the field of Life Sciences. This antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activity, thereby preventing the growth and proliferation of cancer cells.</p>

<p>The GAPDH antibody is a highly effective tool used in Life Sciences research. It is a glycoprotein that specifically targets and binds to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), an enzyme involved in glycolysis. This monoclonal antibody has been extensively tested and validated for use in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>

<p>Mouse monoclonal SWAP70 antibody</p>

<p>Rat monoclonal CD86 antibody (PE)</p>

<p>Rabbit polyclonal NXF3 antibody</p>

<p>Rabbit Polyclonal IkB epsilon antibody (Ser22)</p>

<p>Rabbit polyclonal OLFML2A antibody</p>

<p>Mouse monoclonal RAD9A antibody</p>

<p>The PSR antibody is a highly specialized monoclonal antibody used in various assays and research studies in the field of Life Sciences. It is specifically designed to target alpha-synuclein (α-syn), a protein associated with neurodegenerative disorders such as Parkinson's disease.</p>

<p>Rabbit polyclonal ERP29 antibody (biotin)</p>

<p>Rabbit polyclonal CD3E antibody (FITC)</p>

<p>CIDEC antibody is a polyclonal antibody that is commonly used in life sciences research. It is specifically designed to detect and bind to CIDEC, an antigen that plays a crucial role in lipid metabolism and energy homeostasis. This antibody has been extensively validated for use in immunohistochemistry and other applications.</p>

<p>APOBEC3C antibody was raised in Rabbit using Human APOBEC3C as the immunogen</p>

<p>NAT5 antibody was raised in Rabbit using Human NAT5 as the immunogen</p>

<p>LYN antibody was raised using the N terminal of LYN corresponding to a region with amino acids DPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSF</p>

<p>Recombinant human IL-23</p>

<p>Cytokeratin 20 antibody was raised in mouse using electrophoretically purified cytokeratin 20 from human intestinal mucosa as the immunogen.</p>

<p>The Zika virus NS1 antibody is a potent treatment and/or prophylaxis option for individuals exposed to the Zika virus. This antibody specifically targets the NS1 protein found in the virus and effectively neutralizes its harmful effects. It has been extensively tested on human serum samples, demonstrating strong binding affinity with NS1 proteins.</p>

<p>Affinity purified Rabbit polyclonal TATDN1 antibody</p>

<p>SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS</p>

<p>Rabbit polyclonal Major capsid protein L1 antibody (FITC)</p>

<p>Rabbit polyclonal Dematin antibody (Ser403)</p>

<p>The HPV16 E7 antibody is a dinuclear antibody that specifically targets the human papillomavirus type 16 (HPV16) E7 protein. This antibody is widely used in Life Sciences research to study the expression and function of the HPV16 E7 protein. It can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. The HPV16 E7 antibody is produced using an expression plasmid containing the HPV16 E7 gene. It has been extensively validated and shows high specificity and sensitivity for detecting HPV16 E7 protein in human serum or tissue samples. When used in experiments, this monoclonal antibody effectively binds to the HPV16 E7 protein, leading to lysis of cells expressing this viral protein. It can also be used to detect the presence of HPV16 E7 in virus-infected cells or as a tool for studying the role of HPV16 E7 in cellular processes. Furthermore, this antibody has been</p>

<p>CREB5 antibody was raised in Rabbit using Human CREB5 as the immunogen</p>

<p>N6AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL</p>

<p>Rabbit Polyclonal Tau antibody (Ser235)</p>

<p>The Transferrin antibody is a highly effective and neutralizing monoclonal antibody that is designed to target and inhibit the activity of transferrin. This antibody works by binding to transferrin molecules, preventing them from carrying out their normal functions. By doing so, it effectively neutralizes the activity of transferrin and disrupts processes such as lysis, which are dependent on its function.</p>

<p>ACER1 antibody was raised in rabbit using the C terminal of ACER1 as the immunogen</p>

<p>KCNK5 antibody was raised in Rabbit using Human KCNK5 as the immunogen</p>

<p>CHD1L antibody was raised using the middle region of CHD1L corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL</p>

<p>Rabbit polyclonal NUTF2 antibody</p>

<p>The GAB1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the growth factor GAB1. This antibody is widely used in various applications, including Western blotting, immunohistochemistry, and ELISA.</p>