Anticuerpos primarios

<p>Mouse monoclonal FAHD2A antibody</p>

<p>Rabbit polyclonal TULP3 antibody</p>

<p>Chicken polyclonal MTBE antibody</p>

<p>G10 antibody was raised in mouse using recombinant Human Maternal G10</p>

<p>The DHFR antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various proteolytic processes and is commonly used in immunoassays to detect and quantify the presence of DHFR protein. This antibody specifically targets and binds to the DHFR enzyme, inhibiting its activity and preventing the conversion of dihydrofolate to tetrahydrofolate. By doing so, it disrupts essential cellular processes such as DNA synthesis, repair, and methylation. The DHFR antibody has also been shown to activate the p38 mitogen-activated protein kinase pathway and induce endonuclease activity in certain cell types. Its acidic nature allows for efficient penetration into cells and binding to nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB) transcription factors, influencing gene expression patterns. Researchers rely on the high specificity and sensitivity of this monoclonal antibody for accurate analysis of DHFR-related pathways and understanding its role in growth regulation</p>

<p>Rat monoclonal CD16/32 antibody (biotin)</p>

<p>The Caspase 2 antibody is a cytotoxic monoclonal antibody that targets the Caspase 2 protein. This antibody has been shown to have significant growth factor inhibitory effects and can be used in various research applications. It specifically binds to the Caspase 2 protein, which plays a critical role in apoptosis, or programmed cell death. The antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting experiments to study the expression and localization of Caspase 2 in different tissues and cell types. Additionally, it has been successfully used in combination with other antibodies, such as anti-CD33 antibodies or trastuzumab, to enhance their cytotoxic effects. This highly specific antibody recognizes both native and denatured forms of the Caspase 2 protein and is suitable for use with human serum samples. Its high affinity for Caspase 2 ensures accurate detection and reliable results in Life Sciences research.</p>

<p>Hemopexin antibody is a monoclonal antibody that specifically targets and binds to hemopexin, a protein involved in the transport and scavenging of heme. It has been shown to inhibit the activity of hemopexin and interfere with its interactions with other molecules such as interferon and epidermal growth factor. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors, antibodies, and kinase inhibitors. It can also be used for detecting autoantibodies in human serum samples or studying protein-protein interactions using techniques like immunoprecipitation or Western blotting. Hemopexin antibody is a valuable tool for researchers working in the field of molecular biology and can contribute to advancements in various areas of biomedical research.</p>

<p>POLG2 antibody was raised in rabbit using the N terminal of POLG2 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal GLYATL1 antibody</p>

<p>FAM71D antibody was raised using the middle region of FAM71D corresponding to a region with amino acids VTVVFENNDLIRAKQEEKEKLKNILKPGCLQDTKSKSELKESSKHVTISN</p>

<p>human IgE from myelomatous human serum.</p>

<p>Rabbit polyclonal Ubinuclein antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infection due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The efficacy of this drug has been demonstrated through patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>MRPL3 antibody was raised in Rabbit using Human MRPL3 as the immunogen</p>

<p>ACTB antibody was raised in Rabbit using Human ACTB as the immunogen</p>

<p>Rabbit polyclonal ALOX5 antibody</p>

<p>HSDL1 antibody was raised in Rabbit using Human HSDL1 as the immunogen</p>

<p>Fibrinopeptide A antibody was raised in mouse using Fibrinopeptide A conjugated with carrier protein as the immunogen.</p>

<p>Mouse monoclonal CD3 antibody (PE)</p>

<p>Rabbit polyclonal AGP1 antibody</p>

<p>Mouse monoclonal NIT1 antibody</p>

<p>ASS1 antibody was raised using the N terminal Of Ass corresponding to a region with amino acids YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF</p>

<p>Affinity purified Rabbit polyclonal CSDE1 antibody</p>

<p>Rabbit polyclonal IL3R antibody</p>

<p>CRY2 antibody was raised in Rabbit using Human CRY2 as the immunogen</p>

<p>SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD</p>

<p>CD24 antibody (Azide free) was raised in rat using murine heat stable antigen as the immunogen.</p>

<p>Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL</p>

<p>Rabbit polyclonal MIF antibody (FITC)</p>

<p>SMAD1 antibody was raised in mouse using recombinant Human Smad Family Member 1 (Smad1)</p>

<p>Mouse Monoclonal HIV1 integrase Antibody; immunogen bacterially expressed, hexahistidine amino-terminal tagged HIV-1 integrase (IN) protein (clade B, HXB-3 isolate)</p>

<p>CDH16 antibody was raised in Rabbit using Human CDH16 as the immunogen</p>

<p>DO-11.10 T cell Receptor Monoclonal Antibody</p>

<p>Rabbit polyclonal TNR16 antibody</p>

<p>The Naproxen antibody is a polyclonal antibody used in life sciences research. It specifically targets and binds to Naproxen, a nonsteroidal anti-inflammatory drug (NSAID) commonly used for pain relief and reducing inflammation. This antibody can be used in various applications, including enzyme-linked immunosorbent assays (ELISA), Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The HER4 antibody is a highly effective therapeutic agent that belongs to the class of agonist proteins. It is a monoclonal antibody that specifically targets the HER4 receptor, which plays a crucial role in cell growth and development. This antibody has been extensively studied and proven to be effective in various applications.</p>

<p>RPL3 antibody was raised using the C terminal of RPL3 corresponding to a region with amino acids YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY</p>

<p>PEG10 antibody was raised in Mouse using a purified recombinant fragment of human PEG10 expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CHCHD5 antibody</p>

<p>Affinity purified Rabbit polyclonal PSME3 antibody</p>

<p>FAM83F antibody was raised using the middle region of FAM83F corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP</p>

<p>Rabbit polyclonal Actin pan antibody</p>

<p>Purified Polyclonal GNG8 antibody</p>

<p>Affinity purified Goat polyclonal Eotaxin 3 antibody</p>

<p>Rabbit polyclonal RAC2 antibody</p>

<p>Rabbit polyclonal CSTL1 antibody</p>

<p>Affinity purified Rabbit polyclonal ZNF313 antibody</p>

<p>Rabbit polyclonal NDUC2 antibody</p>

<p>ANTXR1 antibody was raised in Rabbit using Human ANTXR1 as the immunogen</p>