Anticuerpos primarios

<p>The ZAP70 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to the ZAP70 protein, which plays a crucial role in T-cell activation and signaling. This antibody has been extensively studied and proven to be effective in various research applications.</p>

<p>TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC</p>

<p>Rabbit polyclonal AQP2 antibody (Ser261)</p>

<p>Purified Polyclonal MCM4 antibody</p>

<p>CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM</p>

<p>GTPBP5 antibody was raised in Rabbit using Human GTPBP5 as the immunogen</p>

<p>MAGOH antibody was raised in rabbit using the N terminal of MAGOH as the immunogen</p>

<p>MARS antibody was raised in Rabbit using Human MARS as the immunogen</p>

<p>DYNLT1 antibody was raised in Rabbit using Human DYNLT1 as the immunogen</p>

<p>GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGG</p>

<p>Affinity purified Rabbit polyclonal HSD17B4 antibody</p>

<p>Rabbit polyclonal CEBP epsilon antibody</p>

<p>Armenian Hamster monoclonal CD3 antibody (biotin)</p>

<p>The APOBEC3A antibody is a highly specialized antibody that has neutralizing and antiangiogenic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets histidine residues on chemokine proteins, preventing their interaction with receptors and inhibiting their biological activity. The APOBEC3A antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Additionally, this antibody has been found to have low-molecular-weight characteristics, making it easily accessible for various applications. Its ability to target specific growth factors, such as epidermal growth factor and TGF-beta, makes it a valuable tool in studying cellular processes and potential therapeutic interventions. Furthermore, studies have suggested that the APOBEC3A antibody may play a role in reducing amyloid plaque formation, which is associated with neurodegenerative diseases. With its diverse range of applications and potential benefits in research and medicine</p>

<p>NIT2 antibody was raised in Rabbit using Human NIT2 as the immunogen</p>

<p>Mouse monoclonal CD24 antibody (biotin)</p>

<p>The Trypsin antibody is a highly specialized antibody that specifically binds to lysine-specific binding proteins. It has neutralizing properties and can inhibit the activity of these proteins. Additionally, this antibody has been shown to interact with various growth factors and cytokines, including epidermal growth factor (EGF), interferon-gamma (IFN-gamma), and chemokines.</p>

<p>Mouse monoclonal C20orf3 antibody</p>

<p>Mouse monoclonal MHC Class I antibody (biotin)</p>

<p>Mouse monoclonal TNF alpha antibody (FITC)</p>

<p>The ERBB2 antibody is a neutralizing monoclonal antibody that specifically targets the ERBB2 protein. This glycoprotein is known to play a crucial role in cell growth and division. By binding to the ERBB2 receptor, this antibody inhibits the activation of downstream signaling pathways, thereby preventing the proliferation of cancer cells.</p>

<p>Rabbit polyclonal Amyloid beta A4 antibody (Thr743/668)</p>

<p>C4d Complement Monoclonal Antibody</p>

<p>Rabbit polyclonal UBQLN3 antibody</p>

<p>The JNK3 antibody is a polyclonal antibody that specifically targets the growth factor JNK3. This antibody is used in various assays to detect and measure the levels of JNK3 in different samples. It has been shown to be cytotoxic against certain cancer cell lines, such as MCF-7 breast cancer cells. The JNK3 antibody can also be used in research studies to investigate the role of JNK3 in various biological processes, including thrombocytopenia, epidermal growth, hyaluronic acid metabolism, cholinergic neurotransmission, and androgen signaling. Additionally, there are monoclonal antibodies available for specific targeting of JNK3. Overall, the JNK3 antibody is a valuable tool for studying the function and regulation of this important protein.</p>

<p>Rabbit polyclonal ATP1 alpha antibody</p>

<p>The Beta actin antibody is a highly versatile and essential tool in Life Sciences research. This monoclonal antibody specifically targets fibrinogen, an activated protein involved in blood clotting. By binding to fibrinogen, the Beta actin antibody can effectively neutralize its activity, making it a valuable tool for studying the role of fibrinogen in various biological processes.</p>

<p>Rabbit polyclonal PHGDH antibody (biotin)</p>

<p>Mouse monoclonal Placental Protein 14 antibody</p>

<p>Mouse monoclonal CD49e antibody (biotin)</p>

<p>ASF antibody is a highly specialized antibody that is used in various life sciences applications. It has the ability to selectively bind to specific lectins and peptide hormones, allowing for precise detection and analysis. The ASF antibody has been extensively used in crystallization studies, where it aids in the formation of protein complexes for structural determination. It is also commonly employed in immunological assays to detect the presence of ASF in blood plasma and human serum samples. Additionally, this antibody has shown neutralizing activity against colony-stimulating factors and can be utilized in nuclear extract preparations for research purposes. Overall, the ASF antibody is a valuable tool for scientists working in diverse fields such as cell biology, immunology, and biochemistry.</p>

<p>Rabbit polyclonal SOD1 antibody (biotin)</p>

<p>Rabbit polyclonal IKK alpha antibody</p>

<p>The JAK1 antibody is a powerful tool in the field of life sciences. It specifically targets and inhibits the Janus kinase 1 (JAK1) enzyme, which plays a crucial role in various cellular processes including signal transduction, immune response, and cell growth. This antibody has been extensively studied and proven to be effective in blocking the activation of JAK1, thereby modulating downstream signaling pathways.</p>

<p>EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV</p>

<p>The E Cadherin antibody is a monoclonal antibody that specifically targets E-cadherin, a cell adhesion molecule involved in various cellular processes such as growth factor signaling and β-catenin regulation. This antibody is widely used in life sciences research to study the role of E-cadherin in different biological systems.</p>

<p>The Connexin 26 antibody is a highly effective biomolecule used in Life Sciences research. It is a polyclonal antibody that specifically targets and neutralizes the Connexin 26 protein, which plays a crucial role in cell communication. This antibody is widely used to study various cellular processes, including the regulation of glucagon secretion, autoantibody production, and the function of glycoproteins and steroids. Additionally, this monoclonal antibody has been proven to be effective in detecting and studying other biomolecules such as collagen, myelin-associated glycoprotein, interferon, and basic proteins. Researchers rely on the Connexin 26 antibody for its high specificity and reliability in their studies.</p>

<p>Rabbit polyclonal cMet antibody (Tyr1003)</p>

<p>Vasohibin 1 antibody was raised using the middle region of VASH1 corresponding to a region with amino acids SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside:<br>Enhance your tuberculosis treatment with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, an antituberculosis drug from the rifamycins class. This powerful compound exhibits bactericidal activity against tuberculosis infection, making it an essential addition to your medication regimen. By binding to DNA-dependent RNA polymerase, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Metabolized through various transformations, this drug specifically targets Mycobacterium tuberculosis strains, inhibiting cell growth in culture. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective and targeted treatment of tuberculosis infection.</p>

<p>The SMARCB1 antibody is a highly specialized test substance used for immunohistochemical detection. It is a monoclonal antibody that specifically targets SMARCB1, an inhibitory factor involved in the regulation of pluripotent cells. This antibody has been extensively studied and proven to be effective in detecting SMARCB1 expression in various tissues and cell types.</p>

<p>Non-Filamentous Actin antibody was raised in mouse using chemically cross-linked actin dimmer as the immunogen.</p>

<p>LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVV</p>

<p>Mouse monoclonal STAT4 antibody</p>

<p>Purified Polyclonal CUX1 antibody</p>

<p>The LGR4 antibody is a highly sensitive detection tool that utilizes electrochemical impedance spectroscopy to detect the presence of specific antibodies. It is designed to provide accurate and reliable results in various life science applications. The electrode used in conjunction with this antibody allows for ultrasensitive detection, making it ideal for research and diagnostic purposes.</p>

<p>Rabbit polyclonal VATPase G1 antibody (biotin)</p>

<p>EML2 antibody was raised in Rabbit using Human EML2 as the immunogen</p>

<p>Purified Rabbit polyclonal MYBPC1 antibody</p>

<p>Rabbit polyclonal RECK antibody</p>