Anticuerpos primarios

<p>Rabbit polyclonal Peroxiredoxin 1 antibody (biotin)</p>

<p>CD3E antibody was raised in Mouse using a purified recombinant fragment of CD3E expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal EDG3 antibody</p>

<p>Rabbit Polyclonal LDLRAD1 antibody</p>

<p>Rabbit polyclonal STAU2 antibody</p>

<p>Purified Polyclonal ORAOV1 antibody</p>

<p>MCP3 antibody was raised in mouse using highly pure recombinant human MCP-3 as the immunogen.</p>

<p>FBLN5 antibody was raised in Rabbit using Human FBLN5 as the immunogen</p>

<p>Rabbit Polyclonal MARK1/2/3/4 antibody</p>

<p>Affinity purified Rabbit polyclonal Proteasome 20S alpha 7 antibody</p>

<p>Rabbit polyclonal SNAI2 antibody</p>

<p>NDRG1 antibody was raised using the C terminal of NDRG1 corresponding to a region with amino acids GSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGA</p>

<p>The FAK antibody is a pegylated monoclonal antibody that acts as an inhibitor. It neutralizes the activity of focal adhesion kinase (FAK), which plays a crucial role in cell signaling and migration. By inhibiting FAK, this antibody prevents the activation of downstream pathways involved in cell growth and proliferation.</p>

<p>SATB1 antibody was raised in mouse using recombinant Human Satb Homeobox 1 (Satb1)</p>

<p>CEBPA antibody was raised in Rabbit using Human CEBPA as the immunogen</p>

<p>CDC34 antibody was raised in rabbit using the middle region of CDC34 as the immunogen</p>

<p>Purified Rabbit polyclonal PR4b antibody</p>

<p>The Chk1 antibody is a highly specialized monoclonal antibody that targets the glycoprotein known as Chk1. This antibody is specifically designed for use in various scientific research applications within the field of Life Sciences. It has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Influenza A antibody (H1N1) (HRP) was raised in goat using Influenza A, strain USSR (H1N1) as the immunogen.</p>

<p>The BLK antibody is a polyclonal antibody that has neutralizing properties. It can effectively neutralize the effects of ketamine and carbamazepine, making it a valuable tool in research and medical applications. This antibody can also be used in conjunction with monoclonal antibodies to immobilize proteins or other molecules onto surfaces such as electrodes. Additionally, the BLK antibody has proteolytic activity, which allows it to break down fibrinogen and other proteins. It is commonly used in life sciences research, particularly in the study of mesenchymal stem cells. The BLK antibody has also shown promise as a potential family kinase inhibitor and may have applications in cancer research and therapy.</p>

<p>The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.</p>

<p>HNRPDL antibody was raised in Rabbit using Human HNRPDL as the immunogen</p>

<p>ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS</p>

<p>Mouse monoclonal PRKCE antibody</p>

<p>FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP</p>

<p>Gemin 3 Monoclonal Antibody</p>

<p>The hCG alpha antibody is a phosphatase that belongs to the group of monoclonal antibodies. It specifically targets and binds to the hCG (human chorionic gonadotropin) alpha subunit. This antibody has been shown to have high affinity and specificity for the hCG alpha subunit, making it an ideal tool for various applications in life sciences research. The hCG alpha antibody can be used in assays to detect and quantify hCG levels, such as pregnancy tests. It can also be used in immunohistochemistry and immunofluorescence experiments to study the expression and localization of hCG alpha subunit in tissues and cells. The use of this monoclonal antibody, along with other complementary reagents like alkaline phosphatases or insulin antibodies, allows for accurate and reliable detection of hCG alpha subunit in different experimental setups. With its unique properties and versatility, the hCG alpha antibody is a valuable tool for researchers working in the field of reproductive biology</p>

<p>Purified Rabbit polyclonal CCDC99 antibody</p>

<p>Purified Rabbit polyclonal IL13R antibody (Tyr405)</p>

<p>Rabbit Polyclonal IKK beta antibody (Tyr199)</p>

<p>The CD32 antibody is a highly versatile test compound that has a wide range of applications in various fields. It is a monoclonal antibody that specifically targets the CD32 receptor, which plays a crucial role in immune response regulation. This antibody can be used for research purposes, diagnostic tests, and therapeutic interventions.</p>

<p>LARP7 antibody was raised in Rabbit using Human LARP7 as the immunogen</p>

<p>Purified Rabbit polyclonal SLC9A3R2 antibody</p>

<p>EXOSC2 antibody was raised in Rabbit using Human EXOSC2 as the immunogen</p>

<p>ABCB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI</p>

<p>FNBP1L antibody was raised in Rabbit using Human FNBP1L as the immunogen</p>

<p>The TAP antibody is a polyclonal antibody that is used in the field of life sciences. It is specifically designed to target and neutralize the growth factor interleukin-6 (IL-6). This antibody is highly effective in blocking the activity of IL-6, which plays a crucial role in various physiological processes such as inflammation and immune response. The TAP antibody has been extensively tested and proven to have high affinity and specificity for IL-6, making it an ideal tool for researchers studying the role of IL-6 in different biological systems. In addition, this antibody has low viscosity, allowing for easy handling and efficient use in various experimental techniques such as immunohistochemistry and Western blotting. Whether you are conducting basic research or developing therapeutics targeting IL-6, the TAP antibody is an essential tool that will provide reliable and reproducible results.</p>

<p>Lamin A/C Monoclonal Antibody</p>

<p>Rabbit polyclonal RGAP1 antibody</p>

<p>Rabbit polyclonal UBL4B antibody</p>

<p>Affinity purified Rabbit polyclonal C9orf98 antibody</p>

<p>Rat monoclonal CD104 antibody</p>

<p>Albumin antibody was raised in Mouse using Human albumin as the immunogen.</p>

<p>Rabbit polyclonal IFNG antibody (biotin)</p>

<p>The IBA1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the ionized calcium-binding adapter molecule 1 (IBA1) protein, which is primarily expressed in mouse peritoneal macrophages. This antibody is commonly used for immunohistochemistry and immunofluorescence experiments to visualize and study the activation and behavior of macrophages in various tissues.</p>

<p>Calnexin antibody was raised in Mouse using synthetic peptide corresponding to aa (CEAAEERPWLWVVYILTVAL) of human Calnexin, conjugated to KLH as the immunogen.</p>

<p>BIN3 antibody was raised in Rabbit using Human BIN3 as the immunogen</p>

<p>6X His tag Monoclonal Antibody (HRP)</p>

<p>The GIRK1 antibody is a polyclonal antibody used in life sciences research for the detection and analysis of insulin. It specifically targets insulin, a hormone involved in regulating blood sugar levels. The GIRK1 antibody binds to insulin and can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assays (ELISAs). This antibody has been shown to have high specificity and sensitivity for insulin detection. It is particularly useful in studying conditions such as hyperinsulinaemic hypoglycaemia, where there is an excess production of insulin leading to low blood sugar levels. The GIRK1 antibody can also be used to investigate the role of insulin in growth factor signaling pathways and its interactions with other proteins such as phosphatases and kinases. With its ability to accurately detect and analyze insulin, the GIRK1 antibody is a valuable tool for researchers in the field of molecular biology and endocrinology.</p>

<p>PFKM antibody was raised in rabbit using the C terminal of PFKM as the immunogen</p>