Anticuerpos primarios

<p>The CYP2D6 antibody is a polyclonal antibody that specifically targets the CYP2D6 enzyme. This enzyme is responsible for metabolizing a wide range of drugs, including bufuralol and interferon. The CYP2D6 antibody recognizes immunodominant epitopes on the enzyme and can be used in various research applications.</p>

<p>Donkey anti-rat IgG (H + L) (HRP) was raised in donkey using rat IgG (H&amp;L) as the immunogen.</p>

<p>Purified Rabbit polyclonal ATG4A antibody</p>

<p>NBEAL1 antibody was raised using the N terminal of NBEAL1 corresponding to a region with amino acids KDNDKNMSTEDTKKNSDEKTDEEKITSFASANVSSDQWSLEDRHSLDSNT</p>

<p>NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>Armenian Hamster monoclonal CD42d antibody (allophycocyanin)</p>

<p>COPS3 antibody was raised in Rabbit using Human COPS3 as the immunogen</p>

<p>ACTH antibody was raised in mouse using ACTH-BSA as the immunogen.</p>

<p>CNOT2 antibody was raised in Rabbit using Human CNOT2 as the immunogen</p>

<p>Rabbit polyclonal Paxillin antibody (Ser272)</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>Mouse Galectin-3</p>

<p>CD62L antibody was raised in mouse using mouse pre-B cells expressing human L-selectin as the immunogen.</p>

<p>Rabbit polyclonal CRP antibody (HRP)</p>

<p>The ROCK2 antibody is a highly effective antigen inhibitor that is used in Life Sciences research. It is commonly used in experiments involving annexin and extracellular proteins. This antibody is available in both monoclonal and polyclonal forms, allowing researchers to choose the best option for their specific needs. The ROCK2 antibody can be used in various applications, including luminescent and fluorescent assays, as well as in multi-well plate experiments. It is also compatible with recombinant cells and other inhibitors commonly used in the field of Life Sciences. With its high specificity and efficacy, the ROCK2 antibody is a valuable tool for researchers looking to study the role of ROCK2 in cellular processes.</p>

<p>Rabbit polyclonal SCARF1 antibody</p>

<p>Affinity purified Rabbit polyclonal ZNF277 antibody</p>

<p>Rabbit polyclonal RPL3 antibody</p>

<p>Rabbit polyclonal MUC1 antibody (FITC)</p>

<p>Rabbit polyclonal IMPDH2 antibody</p>

<p>GST Monoclonal Antibody  (HRP)</p>

<p>CDC16 antibody was raised in Rabbit using Human CDC16 as the immunogen</p>

<p>CCT4 antibody was raised in Rabbit using Human CCT4 as the immunogen</p>

<p>Purified Polyclonal CD1e antibody</p>

<p>ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL</p>

<p>The NR4A1 antibody is a monoclonal antibody that targets the cholinergic receptor NR4A1. It has been extensively studied in the field of Life Sciences and has shown promising results in various assays. This antibody has been found to be effective in inhibiting the activity of NR4A1, which plays a crucial role in thrombocytopenia and other related conditions. The NR4A1 antibody works by binding to the receptor and blocking its function, leading to a decrease in platelet production. In addition, this antibody has also been used in research studies involving histidine and epidermal growth factor, further highlighting its versatility. With its cytotoxic properties and ability to inhibit choline acetyltransferase, the NR4A1 antibody holds great potential for therapeutic applications. It is available as both a monoclonal and polyclonal antibody, making it suitable for various research needs.</p>

<p>The PARP9 antibody is a glycoprotein that targets telomerase and has been widely used in Life Sciences research. This antibody specifically recognizes PARP9, a protein kinase involved in various cellular processes. It has been shown to be effective in neutralizing atypical hemolytic antibodies and can be used for nuclear staining. The PARP9 antibody is commonly used in experiments involving alpha-fetoprotein detection in human serum samples. Additionally, it has been utilized in studies investigating the effects of taxol on cellular signaling pathways. With its high specificity and sensitivity, this antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>GSK3 alpha antibody was raised in Mouse using a purified recombinant fragment of GSK3 alpha expressed in E. coli as the immunogen.</p>

<p>Mouse monoclonal CXorf26 antibody</p>

<p>Rabbit polyclonal HSPA13 antibody (FITC)</p>

<p>Affinity purified Rabbit polyclonal Malectin antibody</p>

<p>FLYWCH1 antibody was raised in rabbit using the middle region of FLYWCH1 as the immunogen</p>

<p>The CDK2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is commonly used for the detection and analysis of cyclin-dependent kinase 2 (CDK2) activity. The antibody is immobilized on a microsphere or electrode surface, allowing for easy and efficient binding to its target protein.</p>

<p>Gram negative endotoxin antibody was raised in mouse using E. coli J5 whole cells as the immunogen.</p>

<p>ARC antibody was raised in Rabbit using Human ARC as the immunogen</p>

<p>ATP2C1 antibody was raised in Mouse using a purified recombinant fragment of ATP2C1 expressed in E. coli as the immunogen.</p>

<p>NAT13 antibody was raised in Rabbit using Human NAT13 as the immunogen</p>

<p>Rabbit polyclonal ARSK antibody</p>

<p>AGPAT4 antibody was raised in rabbit using the middle region of AGPAT4 as the immunogen</p>

<p>C16ORF48 antibody was raised using the middle region of C16Orf48 corresponding to a region with amino acids SQLLRELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMD</p>

<p>KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP</p>

<p>The GLUT3 antibody is a highly specific monoclonal antibody that targets mesothelin, a protein expressed in various cancer cells. This antibody has been extensively tested and validated for use in various assays, including immunohistochemistry and Western blotting. It can be used as a research tool to study the expression and function of mesothelin in different cell types and tissues.</p>

<p>Rabbit polyclonal Orosomucoid antibody</p>

<p>Purified Polyclonal CD284 antibody</p>

<p>DTD1 antibody was raised in Rabbit using Human DTD1 as the immunogen</p>

<p>Amyloid P antibody was raised in mouse using human serum amyloid P as the immunogen.</p>

<p>The FA7 antibody is a reactive monoclonal antibody that has antiestrogen properties. It is used in various applications, including natriuretic and cytotoxic assays. The FA7 antibody specifically targets the histamine H4 receptor and inhibits its activity, which can have therapeutic implications in antiestrogen therapy. Additionally, this antibody has been shown to modulate protein kinase activity and interact with other molecules such as fatty acids, cystatin, and interleukin-6. With its high specificity and effectiveness, the FA7 antibody is a valuable tool for research and diagnostic purposes.</p>

<p>The GAD67 antibody is a polyclonal antibody that targets the glutamate decarboxylase 67 (GAD67) enzyme. This enzyme plays a crucial role in the synthesis of the neurotransmitter gamma-aminobutyric acid (GABA). The GAD67 antibody can be used in various applications within the life sciences field, including immunohistochemistry, western blotting, and ELISA.</p>

<p>The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.</p>