Anticuerpos primarios
Subcategorías de "Anticuerpos primarios"
- Anticuerpos para la investigación del cáncer(3.721 productos)
- Anticuerpos cardiovasculares(2 productos)
- Biología del desarrollo(764 productos)
- Anticuerpos Epigenéticos(162 productos)
- Anticuerpos inmunológicos(2.585 productos)
- Anticuerpos del metabolismo(286 productos)
- Anticuerpos de microbiología(740 productos)
- Transducción de señales(2.765 productos)
- Etiquetas y marcadores celulares(34 productos)
Se han encontrado 75512 productos de "Anticuerpos primarios"
KCNH6 antibody
KCNH6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVTEK
GILT antibody
The GILT antibody is a cytotoxic monoclonal antibody that specifically targets amyloid plaque protein dimers. It is widely used in Life Sciences research to study the formation and accumulation of amyloid plaques, which are associated with various neurodegenerative diseases such as Alzheimer's disease. This monoclonal antibody has high specificity and affinity for amyloid plaque protein dimers, making it an excellent tool for detecting and quantifying these abnormal protein aggregates. Additionally, the GILT antibody has been shown to have inhibitory effects on the growth factor signaling pathway, making it a potential therapeutic candidate for diseases characterized by excessive cell proliferation. With its exceptional quality and reliability, this antibody is a valuable asset for researchers investigating amyloid-related disorders.
NEDD9 antibody
NEDD9 antibody was raised using the middle region of NEDD9 corresponding to a region with amino acids HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
TNFSF13 antibody
TNFSF13 antibody was raised in rabbit using the middle region of TNFSF13 as the immunogen
SAR1B antibody
SAR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
GBA antibody
GBA antibody is a highly specific monoclonal antibody that targets molecules involved in necrosis factor-related apoptosis-inducing and growth factor signaling pathways. It binds to specific proteins within the protein complex, effectively neutralizing their activity. This antibody can be used in various applications in Life Sciences, including research and diagnostics. GBA antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. It has been shown to have high affinity and specificity for its target molecule, making it a valuable tool in studying various biological processes. Additionally, GBA antibody has been tested and validated in human serum samples, ensuring its reliability and accuracy in clinical settings.
CXCL9 antibody
The CXCL9 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target and neutralize the chemokine CXCL9, which plays a crucial role in various immune responses. This antibody has been extensively tested and proven to have high affinity and specificity for its target.
PODXL antibody
PODXL antibody was raised using the N terminal of PODXL corresponding to a region with amino acids TTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTT
