Aminoácidos (AA)

<p>H-Trp-Trp-OH is a reaction product of the amino acid tryptophan and various electron donors. The radical form of H-Trp-Trp-OH has been studied using 2D nuclear magnetic resonance (NMR) spectroscopy to determine its structure. In addition, H-Trp-Trp-OH has been used to study the mechanism of protein phosphorylation reactions. This chemical can be prepared from a solution of tryptophan in water and an oxidizing agent such as hydrogen peroxide or sodium hypochlorite. The frequency shift observed for H-Trp-Trp-OH was attributed to the presence of a constant that was found to be 10 Hz/M, indicating that this substance is a radical form. The sample preparation technique used in this experiment consisted of adding an equal volume of acetic acid to an unknown sample and then centrifuging it at 5000 rpm for five minutes before measuring its fluorescence emission.</p>

<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Cholecystokinin-33 (1-21) (porcine) H-Lys-Ala-Pro-Ser-Gly-Arg-Val-Ser-Met-Ile-Lys-Asn-Leu-Gln, Ser, Leu, Asp, Pro, His, Arg is a linker that can be used to form peptide conjugates. It can be used as a cell type specific carrier to transport therapeutics across the blood brain barrier. It has also been shown to have therapeutic effects on cells in culture.</p>

<p>Please enquire for more information about Boc-D-Homoarg (Et)2-OH (symmetrical) hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>

<p>Please enquire for more information about MART-1 (27-35) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Edelfosine is a phospholipid analog that has been shown to inhibit insulin-induced glucose uptake in adipocytes. It is a potent inhibitor of the insulin receptor tyrosine kinase and can also act as an allosteric inhibitor of protein kinase C (PKC). Edelfosine inhibits the growth of mammary carcinomas by inhibiting PKC, which leads to a decrease in cell proliferation. This drug also interacts with sulfonic acids, forming hydrogen bonds, which may be the reason for its high-performance liquid chromatography. The molecular weight of edelfosine is 582.3 g/mol.</p>

<p>Please enquire for more information about Heat Shock Protein (hsp) Fragment trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Ile-Thr(Psi(Me ,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>FA-Asp-Ala-OH is a catalytic, acidic, and hydrophilic molecule. It has been shown to be an activating residue for carboxypeptidases. This molecule can hydrolyze other amino acids in the presence of water. Mutations to the FA-Asp-Ala-OH have been shown to have a profound effect on the kinetic properties of carboxypeptidases. The FA-Asp-Ala-OH residue is also important because it can increase the activity of carboxypeptidases by as much as 3 times as compared to wild type enzymes.</p>

<p>Please enquire for more information about H-D-Ala-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-Arg-anilide acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Arg3)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Ac-Gly-Lys-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Met-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Tetrahydropyran-2-methanol is a hydrogenated, hydrated, triflic acid derivative that belongs to the group of organic compounds known as ethers. The presence of a hydroxyl group on one end and a chloride group on the other end provides tetrahydropyran-2-methanol with two reactive sites for reactions with metals. It has been shown to react with metal surfaces in order to form an adduct under acidic conditions that can be used as an ion exchange resin. Tetrahydropyran-2-methanol also reacts rapidly with hydrochloric acid to form tetrahydrothiophene and methanol. This reaction time can be sped up by heating the liquid at atmospheric pressure or by adding sulfuric acid. Tetrahydropyran-2-methanol is also capable of reacting with water in order to produce hydrogen gas and alcohol.</p>

<p>Z-Pro-Leu-Ala-NHOH is a potent inhibitor of stromal cells. It is a hydroxamic acid molecule that acts as an inhibitor of protein synthesis in the ribosome. Z-Pro-Leu-Ala-NHOH has been shown to have potent inhibitory activity against ethyl palmitate and lipiodol, which are used for therapeutic purposes. The molecule also inhibits viscosity in pharmaceutical preparations and pluripotent stem cells. This compound has shown inhibitory activities against stromal cells, which are responsible for growth, differentiation, and tissue repair. It also prevents the formation of embryoid bodies or pluripotent stem cells by suppressing the expression of proteins needed for early development.</p>

<p>Hydroxyl-Tyr-Tyr-OH is a fatty acid that belongs to the group of dietary lipids. It has been shown to have antioxidative properties and can be used in the treatment of pancreatic cancer. Hydroxyl-Tyr-Tyr-OH has also been shown to be an important regulatory molecule that controls certain cellular processes, including cell growth and differentiation. It may be involved in some disease processes, such as cancer and vasoactive intestinal peptide secretion, as well as being a reaction product of other molecules. Hydroxyl-Tyr-Tyr-OH can be found in urine samples after oral ingestion.</p>

<p>Please enquire for more information about Z-Gly-Gly-Arg-4MbNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>