Aminoácidos (AA)

<p>Please enquire for more information about (Tyr69,Ala71·72,Lys74)-C3a (69-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-alpha-Boc-Nbeta-1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)ethyl-D-2,3-diaminopropionic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc-Ser(Val-Fmoc)-OH is a biomolecule that is used for the synthesis of peptides. It has been shown to be an efficient synthetic method for the synthesis of peptides and isopeptides. The use of this biomolecule in peptide synthesis allows for the production of large quantities of peptides without racemization or epimerization that can occur with other methods. This synthetic method provides a means to produce both amino acid and dipeptide sequences, as well as the incorporation of non-natural amino acids.</p>

<p>Please enquire for more information about H-Asp(OtBu)-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Cys(SO3H)-OH sodium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Formyl-(D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-D-Leu-Thr-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Edelfosine is a phospholipid that selectively binds to nuclear DNA, leading to apoptosis. It also binds to the G-protein coupled receptors and inhibits the release of Ca2+ from intracellular stores. Edelfosine has been shown to inhibit the growth of Leishmania in vitro as well as in vivo. This drug is being studied for its potential use in inflammatory bowel diseases, such as Crohn's disease and ulcerative colitis.</p>

<p>Please enquire for more information about Z-D-Alaninol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Acetate salt</p>

<p>Please enquire for more information about (4S,5R)-3-Benzoyl-2-(4-methoxyphenyl)-4-phenyl-5-oxazolidinecarboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Trp-Asn-OH is a synthetic amino acid with the chemical formula H-Trp-Asn-OH. It has been shown to act as a competitive antagonist of the 5HT3 receptor and can be used in the treatment of diseases such as irritable bowel syndrome, depression, and anxiety. The crystal structure of H-Trp-Asn-OH shows that it is an L type polymerase that contains a carboxy group. The docking studies show that this compound binds to the receptor proteins of the subunits and inhibits fission by triphosphatases, which are enzymes involved in cellular processes such as transcription and protein synthesis.</p>

<p>(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) is an asymmetric ligand that is chiral and has been shown to be useful in the preparation of enantiopure alcohols. The compound has been used as a catalyst to prepare aldehydes and ketones. It also has been used in reactions involving dehydration or alkylation. (S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) can be synthesized by reacting molybdenum with an alcohol and adding a base. This reaction produces the desired product with high selectivity, which is due to its chirality.</p>

<p>Kentsin H-Thr-Pro-Arg-Lys-OH is a synthetic peptide that is used as a conditioning agent in vitro and in vivo. It was initially developed as an anti-viral to combat HIV, but has been found to possess contraceptive properties. Kentsin H-Thr-Pro-Arg-Lys-OH inhibits the proliferation of human granulosa cells by blocking ovulation and interfering with the regular development of ovarian follicles. It has been shown to be effective against Pim1, a progesterone receptor on granulosa cells. The concentration response curve for Kentsin H-Thr-Pro-Arg Lys OH shows that it can inhibit ovulation at concentrations as low as 1 μM.</p>

<p>H-Met-Phe-OH is a synthetic polymerase chain that has been shown to be effective in treatment trials for various diseases such as ventricular dysfunction, cancer, inflammatory diseases, and virus. H-Met-Phe-OH binds to the DNA template strand and initiates the synthesis of RNA from nucleotide triphosphates. This molecule also has chemotactic activity and can be used as a diagnostic tool for inflammation or cancer. H-Met-Phe-OH can also be used in biological samples to detect viruses or hepatitis B.</p>

<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-D-Asp-OFm including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-L-Thr-OH is a synthetic peptide that contains the amino acid sequence of l-threonine. It is an amide with a carbamic acid and chloride functional group. The monomers are linked by ring-opening reactions, which are sequences of reactions in which the bond between two adjacent carbon atoms is broken and then immediately formed again with the addition of another molecule. Z-L-Thr-OH has been shown to hydrolyze leukocytes and inhibit bacterial growth in vitro. In vivo studies have also shown that Z-L-Thr-OH inhibits neutrophil recruitment, degranulation, and oxidative burst in response to chemoattractants or bacteria. This peptide has also been shown to be effective against methicillin resistant Staphylococcus aureus (MRSA) and other clinically significant pathogens.</p>

<p>Please enquire for more information about Moth Cytochrome C (MCC) Fragment including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 2-(Boc-Aminomethyl)pyrrolidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about CART (62-76) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Enterotoxin STp (E. coli) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide W-30 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>

<p>H-Leu-Ser-Ala-Leu-OH is a chemical compound that has been shown to bind to 5-HT1B receptors. This receptor belongs to the 5HT1 family of serotonin receptors, which are G protein coupled receptors. The 5HT1B receptor has been shown to have a role in locomotor activity and dopamine release. HLSALLOH is also a specific antibody that reacts with the 5HT1B receptor in rats. The location of this receptor is on the dorsal raphe nucleus and other parts of the brainstem. HLSALLOH has a pH optimum of 6.0 and can be used as an immunogen for polyclonal antibodies against 5HT1B receptors.</p>

<p>H-Ala-Ala-Tyr-Ala-Ala-OH is a butanedione that hydrolyzes to form acetaldehyde. It is a chaperone and amide that, in the presence of water, forms peptides. The kinetic constants are dependent on the pH of the reaction. This product has been shown to have proctolin activity and is an enkephalinase inhibitor, which is involved in pain sensation. H-Ala-Ala-Tyr-Ala-Ala-OH has been used as an ion exchanger and carboxylate isomerizing agent.</p>

<p>H-[15N]Tyr-OH is a metabolite of tyrosine. It is the conjugate acid of propionic acid, and the conjugate base of 4-hydroxybenzyl. H-[15N]Tyr-OH is a phenylalanine and aromatic amino acid that has an aromatic ring with a phenyl substituent. This metabolite is hydroxy, which means it has one hydroxyl group on the phenyl ring. H-[15N]Tyr-OH binds to daphnia in vivo, causing death. The cause for this may be due to its ability to react with oxygen, forming reactive oxygen species (ROS).</p>

<p>Please enquire for more information about H-Thr-Pro-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-trans-4-aminocyclohexane acetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Gly-Gly-His-OH is a synthetic amino acid that has been shown to bind to metal ions such as copper and zinc. The interaction with the metals may be due to the presence of the carboxyl group on the side chain. Z-Gly-Gly-His-OH is also able to catalyze the hydrolysis of ester bonds in organic solvents, which may be due to its interactions with cations. Z-Gly-Gly-His-OH can also interact with enzymes such as protein kinases, leading to changes in enzyme activity.</p>

<p>Please enquire for more information about DNA Transcription Inhibitory Peptide Pyr-Asp-Asp-Ser(PO3H2)-Asp-Glu-Glu-Asn-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phenylalanine methyl ester is a metabolite of phenylalanine that is formed by the action of the enzyme phenylalaninase. It has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of pro-inflammatory cytokines such as colony-stimulating factor (CSF) and tumor necrosis factor alpha (TNFα). This drug also inhibits amyloid protein aggregation, a process that causes Alzheimer's disease. Phenylalanine methyl ester has been used in clinical trials for treating infectious diseases. The drug increases the number of white blood cells in the body and stimulates antibody production. Phenylalanine methyl ester binds to sodium citrate and forms stable complexes with hydrogen bonds or ionic interactions.</p>

<p>Please enquire for more information about Saposin C (15-32) (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>

<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Tos-Gly-Pro-Lys-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Leu-Phe-OH is a peptide that has been isolated from human macrophages. The peptide is homologous to the amino acid sequence of casein and has shown anti-inflammatory properties in the inhibition of the enzymatic reaction between casein and sodium citrate. When incubated with polymorphonuclear leukocytes, H-Gly-Leu-Phe-OH showed an inhibitory effect on their growth. This peptide also inhibited the enzymatic reaction between casein and sodium citrate, which may be due to its reversed phase high performance liquid chromatography (RP HPLC) method.</p>

<p>H-D-Arg(Me)-OH is a peptide that has been shown to inhibit the proliferation of cancer cells in culture. It inhibits the growth of tumor cells by blocking the activity of the oxytocin receptor, which regulates cell adhesion and migration. The H-D-Arg(Me)-OH acetate salt has also been shown to promote the differentiation of basophilic leukemia cells into normal myeloid cells. This peptide is used as a control for incubated cell cultures, such as liver cells, and can be used to study protein synthesis.</p>

<p>Please enquire for more information about FA-Gly-Nva-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about DABCYL-gamma-Abu-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-D-His(1-Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>

<p>H-D-Val-Leu-Arg-pNA·2 AcOH is a kallikrein inhibitor that can be used as a blood pressure lowering agent. It inhibits the enzymatic activity of kallikrein, which is responsible for the conversion of kininogen to bradykinin, and thus prevents the production of natriuretic peptides. H-D-Val-Leu-Arg-pNA·2 AcOH has been shown to decrease blood pressure in animals by inhibiting filtration through the glomerulus and by blocking renin release from juxtaglomerular cells.</p>

<p>Please enquire for more information about (Cys2)-Neuropeptide Y (1-4)-8-aminooctanoyl-(D-Cys27)-Neuropeptide Y (25-32) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IQB-782 is a mucolytic agent with mucolytic expectorant activity for the study of obstructive lung disease.</p>

<p>Please enquire for more information about (D-Trp6)-LHRH (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Gly-Gly-pNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Suc-Phe-Ala-Ala-Phe-pNA is a serine protease with natriuretic properties. It has been shown to have high salt and pH optima and to be reactive at physiological pH. Suc-Phe-Ala-Ala-Phe-pNA has been sequenced and found to have a carboxy terminal reactive site. There are eight cysteine residues in the amino acid sequence of this protease, four of which are in the reactive site. This protease also has vasoactive intestinal peptide (VIP) activity, which is involved in inflammatory diseases.</p>

<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>

<p>Please enquire for more information about 3-Boc-amino-2,6-dioxopiperidine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Myelin Basic Protein (83-99) (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin (200-400 mesh) is a versatile research chemical used in various applications. It contains aminooxyacetic acid, which is commonly used in the synthesis of fatty acids and other organic compounds. This resin is often employed in the purification and separation of target molecules, such as ochratoxin, collagen, synthetic cannabinoids, naphthalene derivatives, fatty acids, steroids, and more. Additionally, it can be utilized as an inhibitor for various enzymes or complexes like arp2/3 complex. The Boc 8-Lys4-Lys2-Lys-b-Ala-PAM resin has also been used in the synthesis of cefazolin sodium, an antibiotic widely used in medical settings. With its high-quality composition and fine particle size (200-400 mesh), this resin offers excellent performance and efficiency for biomass-related studies and other research endeavors.</p>

<p>Please enquire for more information about Atrial Natriuretic Factor (5-27) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>

<p>Boc-Phe-Phe-OH is a linker that is used to create homologues. It has been shown to be able to form supramolecular structures and encapsulate biomolecules, such as amino acids. The ester linkage of Boc-Phe-Phe-OH can be modified by the addition of a carboxylic acid, which can lead to changes in its fluorescence and magnetic properties. Boc-Phe-Phe-OH is primarily used as an intermediate for fluorescent probes or other molecules.</p>

<p>Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about ent-[Amyloid b-Protein (20-16)]-b-Ala-D-Lys(ent-[Amyloid b-Protein (16-20)]) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-MCH (salmon) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-3-(2-naphthyl)-L-alanine is a supramolecular compound that functions as an inhibitor of prostate cancer cells. It inhibits the uptake of metal chelates by prostate cancer cells and stabilizes them, which may lead to a diagnostic and therapeutic agent for prostate cancer. Fmoc-3-(2-naphthyl)-L-alanine has also been shown to inhibit the growth of human serum prostate cancer cells in vitro and in vivo models. This molecule is a bifunctional compound that can be used as both an antigen and a surrogate for cytosolic prostate specific antigen (PSA) levels. Fmoc-3-(2-naphthyl)-L-alanine has been shown to bind to the PSA protein, which is normally found on the surface of prostate epithelial cells. This binding prevents it from being released into the blood circulation, where it would otherwise be measured by a PSA test</p>

<p>Please enquire for more information about Entero-Kassinin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.</p>

<p>Please enquire for more information about CD36 (93-110)-Cys including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>The product is a neutral amino acid with an aliphatic side-chain. The product has been shown to be stable when diluted, and is not subject to hydrolysis. It can be used as a reagent for peptide synthesis because it does not interfere with the reaction or alter the yield of desired products. The product has been shown to be reliable and produce polypeptides that are chemically identical to those obtained by other methods. It has been found that the product is additive in peptide synthesis reactions, so that it can be substituted for any one of the components without altering the yield of desired products.</p>

<p>The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.</p>

<p>Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>

<p>LHRH (free acid) trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-OH trifluoroacetate salt is a decapeptide that is the most potent form of the hormone luteinizing hormone releasing hormone (LHRH). It has been shown to bind to surface receptors and activate a G protein, which activates adenyl cyclase. This leads to increased levels of cyclic adenosine monophosphate (cAMP) in cells. LHRH also binds to blood vessels and causes vasodilation. LHRH also binds to pyroglutamic acid, which is an amino acid found in peptides that have affinity for peptidases. This binding causes the release of peptidases from the cell membrane, uncovers receptor sites, and increases cAMP production. LHRH has also been shown to inhibit kidney function</p>

<p>Bradykinin (BK) is a peptide hormone that is released by the endothelium of blood vessels in response to injury. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is a synthetic version of the BK sequence with sulfate groups on the amino acids and an additional acid substitution. This molecule has been shown to be fully functional as a copolymer in thrombin activation, oligopeptide, and angiotensin production. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is stable at pH 3 and above, which makes it suitable for use in nutrient media, such as media for growing bacteria or yeast. It also has been shown to have platelet aggregation properties similar to those found in natural BK.</p>

<p>Please enquire for more information about (D-Tyr1,N-Me-Phe3)-Neuropeptide FF trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Aloc-Ser-OMe is an enzyme that catalyzes the cleavage of 1,4-linked alpha-D-galactosides. It has been shown to be a useful reagent for the synthesis of alkyl glycosides. Aloc-Ser-OMe can be used in enzymatic synthesis or chemoenzymatic synthesis. This enzyme has excellent stereospecificity and is quantitatively active at pH 4.5 to 5.0 and at temperatures ranging from 20°C to 40°C. The enzyme can also catalyze transglycosylation reactions with beta-glucosidase, producing galactoarabinan oligosaccharides with various degrees of polymerization.</p>

<p>H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt is a compound that can be used as a cancer treatment. It has been shown to inhibit the growth of human retinal pigmented epithelial cells (p. pastoris) and induce apoptosis in these cells. H-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt interacts with the membrane of cells, blocking the binding site for growth factor and preventing the activation of downstream signaling pathways. This agent also binds to lysine residues on peptides, which are then degraded by proteases. H-Argo Arg Arg Arg Arg Arg Arg OH trifluoroacetate salt has been shown to have an affinity for flavone luteolin at neutral pH, as well as fatty acid molecules.</p>

<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>

<p>Please enquire for more information about Acetyl-(Asn30,Tyr32)-Calcitonin (8-32) (salmon I) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-Lys-Leu-Arg-Glu-Arg-Leu-Lys-Gln-Arg-Gln-Gln-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Ile-Leu-Phe-Leu-Gln-Glu-Gly-Gly-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Thrombospondin-1 (1016-1021) (human, bovine, mouse) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>

<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about GM-CSF (17-31) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Leucokinin II is a fatty acid. It is a diagnostic agent that can be used to identify bacteria, such as Stenotrophomonas maltophilia, which produce β-amino acids. Leucokinin II can also be used for the diagnosis of cancer and inflammatory diseases. Its analogs are being studied for their potential use in diagnosing infectious diseases. Leucokinin II binds to the receptor and activates it, resulting in the production of biochemical or electrochemical signals that can be detected by a detector.</p>

<p>Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Asp(OcHex)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Nle 13,Glu14)-Motilin (human, porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 4-[2-(Fmoc-amino)ethyl]-1-piperazineacetic acid dihydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>