Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29598 productos de "Péptidos"
H-VLKDAIKDL-OH
Peptide H-VLKDAIKDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTFASLSELHCDK-OH
Peptide H-GTFASLSELHCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPFA-OH
Peptide H-VPFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IAIPTNFTI-OH
Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNYMYAR-OH
Peptide H-NNYMYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HP-OH
Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFDQIDNAPEEK-OH
Peptide H-AFDQIDNAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALYLQQNW-OH
Peptide H-IALYLQQNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C55H81N13O14Peso molecular:1,148.32 g/molH-GERIVDII-OH
Peptide H-GERIVDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TFSWASVTSK-OH
Peptide H-TFSWASVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGSGLVGR-OH
Peptide H-SGSGLVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TWSKVGGHLRPGIVQSG-OH
Peptide H-TWSKVGGHLRPGIVQSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALTNSVNEALLNPSR-OH
Peptide H-IALTNSVNEALLNPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RMPEAAPPV-OH
Peptide H-RMPEAAPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VYVHPF-OH
Peptide H-VYVHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH
H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fórmula:C203H311N55O60SPeso molecular:4,514.1 g/molH-GCTVHG-OH
Peptide H-GCTVHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MEVDPIGHLY-OH
Peptide H-MEVDPIGHLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C53H80N12O16SPeso molecular:1,173.35 g/molH-CSTGSIDMVD-OH
Peptide H-CSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TRFASVYAW-OH
Peptide H-TRFASVYAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLSESQVK-OH
Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIQTAVR-OH
Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDTAYMELSSLR-OH
Peptide H-STDTAYMELSSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYVLVMLVL-OH
Peptide H-IYVLVMLVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGDP-OH
Peptide H-GPGDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MIASHLAFEKLSKLGSKHTML-NH2
H-MIASHLAFEKLSKLGSKHTML-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KDQAQLNSWGCAFRQVCHT-OH
CAS:H-KDQAQLNSWGCAFRQVCHT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C93H140N30O28S2Peso molecular:2,190.45 g/molH-GIPAEDIPRL-OH
Peptide H-GIPAEDIPRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SRKEYVSMY-OH
Peptide H-SRKEYVSMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HEAWITLEK-OH
Peptide H-HEAWITLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRIRPRPPRLPRPRPRP-OH
Peptide H-RRIRPRPPRLPRPRPRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EPLSQSQITAY-OH
H-EPLSQSQITAY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH
H-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-DAPEEEDHVLVLR-OH
H-DAPEEEDHVLVLR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EFTPVLQADFQK-OH
Peptide H-EFTPVLQADFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TEKLWVTVYYGVPVWREATT-OH
Peptide H-TEKLWVTVYYGVPVWREATT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGKRK-OH
Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPRKPIKCW-OH
Peptide H-GPRKPIKCW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLHVMHKVAPPRGGGC-OH
Peptide H-GLHVMHKVAPPRGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KPIVQYDNF-OH
Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKFERLQTVTNYFITSE-OH
Peptide H-AKFERLQTVTNYFITSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFSPEVIPMFSALSEGATPQ-OH
Peptide H-AFSPEVIPMFSALSEGATPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAQELEEK-OH
Peptide H-VAQELEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQSGIGEK-OH
Peptide H-FQSGIGEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGTASVVCLLNNFYPR-OH
Peptide H-SGTASVVCLLNNFYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NFMESLPRLGMH-NH2
Peptide H-NFMESLPRLGMH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFER-OH
Peptide H-LLFER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WGW-OH
Peptide H-WGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GISYGRQLGKKKHRRRAHQ-OH
Peptide H-GISYGRQLGKKKHRRRAHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VERYLRDQQLLGIWG-OH
Peptide H-VERYLRDQQLLGIWG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SHHKAKGK-OH
Peptide H-SHHKAKGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KAAVDLSHFL-OH
Peptide H-KAAVDLSHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AGYLMELCC-OH
Peptide H-AGYLMELCC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISNQLTLDSNTKYFHKLN-OH
Peptide H-ISNQLTLDSNTKYFHKLN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HKSNTCRAMER-OH
Peptide H-HKSNTCRAMER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLSSSPHLPPSSYFNASGR-OH
Peptide H-FLSSSPHLPPSSYFNASGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQLGVRKELRGV-OH
Peptide H-EQLGVRKELRGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EALDFFAR-OH
Peptide H-EALDFFAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKEESLDSDLYAELR-OH
Peptide H-GKEESLDSDLYAELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDDYYYGFGCNKFGRPRDD-OH
Peptide H-CDDYYYGFGCNKFGRPRDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPNALTDDR-OH
Peptide H-VPNALTDDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILQQLLFI-OH
Peptide H-ILQQLLFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IKEFLQRFIHIVQSIINTS-OH
Peptide H-IKEFLQRFIHIVQSIINTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSDPVWQVK-OH
Peptide H-HSDPVWQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WGPSLYSIL-OH
Peptide H-WGPSLYSIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA leader peptide LLL (R5Q)
Mutant fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40. When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack. Peptide H-VMAPQSLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAMSPMSWNSDASTSEAS-OH
Peptide H-SGAMSPMSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFAYPDTHR-OH
Peptide H-LFAYPDTHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDSPDRPWNPPTFSPALL-OH
Peptide H-LDSPDRPWNPPTFSPALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFQLFGSPPGQR-OH
Peptide H-SFQLFGSPPGQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLSFSIVSL-OH
Peptide H-KLSFSIVSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQDVNCTEV-OH
Peptide H-YQDVNCTEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVVVGAGDVGK-OH
Peptide H-LVVVGAGDVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLLTKILTI-OH
Peptide H-FLLTKILTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGGGGG-OH
Peptide H-GGGGGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AADDTWEPFASGK-OH
Peptide H-AADDTWEPFASGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKRNRTLTV-OH
Peptide H-KKRNRTLTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGLKFRQL-OH
Peptide H-MGLKFRQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEVK-OH
Peptide H-LEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KSAPATGGVK-OH
Peptide H-KSAPATGGVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATVVYQGER-OH
Peptide H-ATVVYQGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RVYIHPF-OH
Peptide H-RVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQSSPAKPDSSFYK-OH
Peptide H-YQSSPAKPDSSFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYTYDELFQLK-OH
Peptide H-KYTYDELFQLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SEKTQLYNRPHEEPSNSC-OH
Peptide H-SEKTQLYNRPHEEPSNSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAFTSHEHF-OH
Peptide H-VAFTSHEHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALQGVGDMGR-OH
Peptide H-EALQGVGDMGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLRSSVPGV-OH
Peptide H-RLRSSVPGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GILLPQK-OH
Peptide H-GILLPQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ESDTSYVSLK-OH
Peptide H-ESDTSYVSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADLMGYIPLV-OH
Peptide H-ADLMGYIPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QIYGAK-OH
Peptide H-QIYGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVTSIHSLLDEGKQS-OH
Peptide H-NVTSIHSLLDEGKQS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PIKQLNGRTKTASGIRK-OH
Peptide H-PIKQLNGRTKTASGIRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YYIAASYVK-OH
Peptide H-YYIAASYVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-APGP-OH
Peptide H-APGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFAQ-OH
Peptide H-VFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RPAIAINNPYVPR-OH
Peptide H-RPAIAINNPYVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGGGRGDY-OH
Peptide H-GGGGRGDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
