Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29608 productos de "Péptidos"
H-EGLELPEDEEEK-OH
Peptide H-EGLELPEDEEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EYRALQLHL-OH
Peptide H-EYRALQLHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
3-Amino-3-(4-chlorophenyl)propionic Acid
CAS:Fórmula:C9H10ClNO2Pureza:>97.0%(T)(HPLC)Forma y color:White to Almost white powder to crystalPeso molecular:199.63H-KAVSNFATM-OH
Peptide H-KAVSNFATM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR-OH
Peptide H-LLVVYPWTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AQAASLEAEHQAIIR-OH
Peptide H-AQAASLEAEHQAIIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WFVI-OH
Peptide H-WFVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVLAVFGK-OH
Peptide H-TVLAVFGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAFV-OH
Peptide H-AAFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEKYAQAYPNVS-OH
Peptide H-NEKYAQAYPNVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIQGITKPAIRRLARRG-OH
Peptide H-NIQGITKPAIRRLARRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGFFGNPR-OH
Peptide H-DGFFGNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLNSLSELEVK-OH
Peptide H-NLNSLSELEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YGGFLRRIRPKLK-OH
Peptide H-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAPDNRETF-OH
Peptide H-AAPDNRETF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIAQDFKTDLR-OH
Peptide H-EIAQDFKTDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASVLSGGELDRWEKI-OH
Peptide H-ASVLSGGELDRWEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGDFFR-OH
Peptide H-LLGDFFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVSPFIPL-OH
Peptide H-IVSPFIPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPYNETARVKPKTLQLLDIQ-OH
Peptide H-GPYNETARVKPKTLQLLDIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ-OH
Peptide H-EVEDPQVAQLELGGGPGAGDLQTLALEVAQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNFGDDIPSALR-OH
Peptide H-LNFGDDIPSALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYLPYWPVLSSL-OH
Peptide H-KYLPYWPVLSSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HIPRT-OH
Peptide H-HIPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RKSIRIGPGQTFYAT-OH
Peptide H-RKSIRIGPGQTFYAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLFVLGLFL-OH
Peptide H-SLFVLGLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH
Peptide H-SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILSPFLPLL-OH
Peptide H-ILSPFLPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STALQLIQR-OH
Peptide H-STALQLIQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNLGLDLR-OH
Peptide H-YNLGLDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FG-OH
Peptide H-FG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EKYNLTSVL-OH
Peptide H-EKYNLTSVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAFDLSFFL-OH
Peptide H-AAFDLSFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NPPIPVGEIYKRWII-OH
Peptide H-NPPIPVGEIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPYV-OH
Peptide H-GPYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTLTAAITTVLAK-OH
Peptide H-TTLTAAITTVLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILQGGVGIPHIR-OH
Peptide H-ILQGGVGIPHIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEQQWNFAGIR-OH
Peptide H-TEQQWNFAGIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SACDVSVRV-OH
Peptide H-SACDVSVRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LITAHVEPLLAR-OH
Peptide H-LITAHVEPLLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EDHLFR-OH
Peptide H-EDHLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRKWQKTGHAVRAIGRL-OH
Peptide H-RRKWQKTGHAVRAIGRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CRQLSQFCLNRHR-OH
Peptide H-CRQLSQFCLNRHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSDFKTWL-OH
Peptide H-VLSDFKTWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPFERATVM-OH
Peptide H-LPFERATVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CDCRGDCFC-OH
Peptide H-CDCRGDCFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QGAR-OH
Peptide H-QGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTVDK-OH
Peptide H-LTVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNKIVRMYSPTSI-OH
Peptide H-LNKIVRMYSPTSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITHTGEKPY-OH
Peptide H-ITHTGEKPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ADHVSFNGYER-OH
Peptide H-ADHVSFNGYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MVRRFLVTLRIRRACGPPRV-OH
Peptide H-MVRRFLVTLRIRRACGPPRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VITAFNDGLNHLDSLK-OH
Peptide H-VITAFNDGLNHLDSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH
Peptide H-SANSNPAMAPRERKAGCKNFFWKTFTSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IIDNKPSIDSYSK-OH
Peptide H-IIDNKPSIDSYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPEEKSAVTAL-OH
Peptide H-VHLTPEEKSAVTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RDG-OH
Peptide H-RDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MOTS-c (Mouse)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C69H99N13O17S2Peso molecular:1,446.74 g/molH-ISGLIYEETR-OH
Peptide H-ISGLIYEETR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TEYKLVVVGADGVGK-OH
Peptide H-TEYKLVVVGADGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CINGACWTV-OH
Peptide H-CINGACWTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSTSEIASHLPTK-OH
Peptide H-LSTSEIASHLPTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLETEILESLK-OH
Peptide H-SLETEILESLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NEALIALLR-OH
Peptide H-NEALIALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TESTLNALLQR-OH
Peptide H-TESTLNALLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LWEGSTSR-OH
Peptide H-LWEGSTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIVDSYLPVILDIIK-OH
Peptide H-EIVDSYLPVILDIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LRSRYWAI-OH
Peptide H-LRSRYWAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RMYSPTSIL-OH
Peptide H-RMYSPTSIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QGVDDAFYTLVR-OH
Peptide H-QGVDDAFYTLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGSGGSGGGGSGGGGS-OH
Peptide H-GGSGGSGGGGSGGGGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TNFDNDIALVR-OH
Peptide H-TNFDNDIALVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVESITDIR-OH
Peptide H-TVESITDIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLPSDFFPS-OH
Peptide H-FLPSDFFPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CPLSKILLARLFLYA-OH
Peptide H-CPLSKILLARLFLYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALDLLDR-OH
Peptide H-ALDLLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NPTYKFFE-OH
Peptide H-NPTYKFFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPYGSFKHV-OH
Peptide H-VPYGSFKHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLEWVAR-OH
Peptide H-GLEWVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AYSSGAPPMPPF-OH
Peptide H-AYSSGAPPMPPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQAPNLVYMVTGNPASDEIK-OH
Peptide H-EQAPNLVYMVTGNPASDEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGTLGHPGSLDETTYER-OH
Peptide H-SGTLGHPGSLDETTYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVLGDQDLK-OH
Peptide H-VVLGDQDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CLEPYTA-OH
Peptide H-CLEPYTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLQPLTFLL-OH
Peptide H-KLQPLTFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EILVGDVGQTVDDPYATFVK-OH
Peptide H-EILVGDVGQTVDDPYATFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CKKKKKC-OH
Peptide H-CKKKKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLTHAQSTLDAK-OH
Peptide H-HLTHAQSTLDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQAAMQMLKETINEE-OH
Peptide H-HQAAMQMLKETINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPDIYNPQAGSLK-OH
Peptide H-SPDIYNPQAGSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FWQKMSFA-OH
Peptide H-FWQKMSFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH
CAS:Peptide H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:4,195.89 g/molH-DLPSPIER-OH
Peptide H-DLPSPIER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVQYLNEIK-OH
Peptide H-GVQYLNEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPYGYGPGGVAGAAGK-OH
Peptide H-LPYGYGPGGVAGAAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIKRTVAAPSVFIFPPSDEQLKSGTA-OH
Peptide H-EIKRTVAAPSVFIFPPSDEQLKSGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LCVQSTHVD-OH
Peptide H-LCVQSTHVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TGSTAVPYGSFKHVDTRLQ-OH
Peptide H-TGSTAVPYGSFKHVDTRLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RDYVDRFFKTL-OH
Peptide H-RDYVDRFFKTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
