Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29773 productos de "Péptidos"
H-YLYRLFRKSNLKPFE-OH
Peptide H-YLYRLFRKSNLKPFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSIR-OH
Peptide H-WYQSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RYPLTFGWCF-OH
Peptide H-RYPLTFGWCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPETER-OH
Peptide H-TPETER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLLSAALSAGK-OH
Peptide H-QLLLSAALSAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DHIGTR-OH
Peptide H-DHIGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LYPFTWDAVR-OH
Peptide H-LYPFTWDAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIADIFEYTAK^-OH
Peptide H-IIADIFEYTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQAEPDRAHYNIVTF-OH
Peptide H-GQAEPDRAHYNIVTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C145H240N44O48S2Peso molecular:3,431.9 g/molH-WY-OH
Peptide H-WY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C192H295N61O60SPeso molecular:4,449.9 g/molH-SGSVIDQSR-OH
Peptide H-SGSVIDQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLWEWASVR-OH
Peptide H-YLWEWASVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YFDSFGDLSSASAIMGNAK-OH
Peptide H-YFDSFGDLSSASAIMGNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR-OH
Peptide H-LHGGSPWPPCQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KHFGKDSNFPFGT-OH
H-KHFGKDSNFPFGT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RERQR-OH
Peptide H-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPVALGLK-OH
Peptide H-IPVALGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NLLRLTG-OH
Peptide H-NLLRLTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MAGDIS-OH
Peptide H-MAGDIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVYDGREHTV-OH
Peptide H-GVYDGREHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STELLIRK-OH
Peptide H-STELLIRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KMLKEMGEV-OH
Peptide H-KMLKEMGEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLPAKAPLL-OH
Peptide H-RLPAKAPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITPSYVAFTPEGER-OH
Peptide H-ITPSYVAFTPEGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVGGWECEK-OH
Peptide H-IVGGWECEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IEIKDTKEAL-OH
Peptide H-IEIKDTKEAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HTTDPSFLGRY-OH
Peptide H-HTTDPSFLGRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:1,293.4 g/molH-CFFQNCPKG-NH2
CAS:H-CFFQNCPKG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C46H65N13O11S2Peso molecular:1,040.23 g/molH-KAGQVVTIW-OH
Peptide H-KAGQVVTIW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AYVELQTEL-OH
Peptide H-AYVELQTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A
Peptide H-GKPIPNPLLGLDSTRTGHHHHHH-OH 817A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WFDV-OH
Peptide H-WFDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR-OH
Peptide H-RRRNEQELLELDKWASLWNWFDITNWLWYIRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TTDPSFLGRY-OH
Peptide H-TTDPSFLGRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:1,156.3 g/molH-RRYGTSKYQ-OH
Peptide H-RRYGTSKYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HYGGLTGLNK-OH
Peptide H-HYGGLTGLNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLLKLTPLL-OH
Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASNENMDTM-OH
Peptide H-ASNENMDTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLNELQALIEAHFENR-OH
Peptide H-DLNELQALIEAHFENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CASDAKAYDTEVHNV-OH
H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GLSPTVWLSV-OH
Peptide H-GLSPTVWLSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ERSPVIQTL-OH
Peptide H-ERSPVIQTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYFPHFDVSHGSAQVK-OH
Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSKKPVPIIYCNRRTGKCQRM-OH
Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GPFPIIV-OH
Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYPTNGYTR-OH
Peptide H-IYPTNGYTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RKIYDLIEL-OH
Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAMSPMSWNSDASTSEAS-OH
Peptide H-SGAMSPMSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFAYPDTHR-OH
Peptide H-LFAYPDTHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YQGFIFDIVTK-OH
Peptide H-YQGFIFDIVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDSPDRPWNPPTFSPALL-OH
Peptide H-LDSPDRPWNPPTFSPALL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVIT-OH
Peptide H-VVIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFVRSIGSKGGKLAAGKYTDAVTV-OH
Peptide H-FFVRSIGSKGGKLAAGKYTDAVTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GSMVVIPTYALHHDPK-OH
Peptide H-GSMVVIPTYALHHDPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GCRDQGWIGQPGDRCG-OH
Peptide H-GCRDQGWIGQPGDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TKCVLS-OH
Peptide H-TKCVLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SGDSEVYQLGDVSQK-OH
Peptide H-SGDSEVYQLGDVSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLFEQVMRI-OH
Peptide H-RLFEQVMRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RTKMRMRRM-OH
Peptide H-RTKMRMRRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GIT-OH
Peptide H-GIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTLLALHR-OH
Peptide H-FQTLLALHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARVYIHPF-OH
Peptide H-ARVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YVDDVVLGA-OH
Peptide H-YVDDVVLGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TGDIVEFVCK-OH
Peptide H-TGDIVEFVCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELQLLMQSTPPTNNR-OH
Peptide H-ELQLLMQSTPPTNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IWLDNVR-OH
Peptide H-IWLDNVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEEQEPELTSTPNFVVEVIK-OH
Peptide H-VEEQEPELTSTPNFVVEVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAMSQVTNSATIMMQ-OH
Peptide H-EAMSQVTNSATIMMQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DQGGELLSLR-OH
Peptide H-DQGGELLSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYALSQGTTIR-OH
Peptide H-FYALSQGTTIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APAATVVNVDEVR-OH
Peptide H-APAATVVNVDEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ANQECDVT-OH
Peptide H-ANQECDVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFSTASAITPSVSR-OH
Peptide H-SFSTASAITPSVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SDAPIGK-OH
Peptide H-SDAPIGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VRKKNMAKQA-OH
Peptide H-VRKKNMAKQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VFGFPVHYTDVSNMSR-OH
Peptide H-VFGFPVHYTDVSNMSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIPTVNENLENYYLEVNQLEK-OH
Peptide H-NIPTVNENLENYYLEVNQLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLLGTEFQV-OH
Peptide H-RLLGTEFQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA leader peptide LLL (T6A)
Peptide H-VMAPRALLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NFPSPVDAAFR-OH
Peptide H-NFPSPVDAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AILNYIASK-OH
Peptide H-AILNYIASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFPSVLR-OH
Peptide H-GFPSVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLKEKGGL-OH
Peptide H-FLKEKGGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TITNDR-OH
Peptide H-TITNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGQ-OH
Peptide H-QGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LEDVFAGK-OH
Peptide H-LEDVFAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VRSYCYEASISDMAS-OH
Peptide H-VRSYCYEASISDMAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASGFTFMSSAVQWVR-OH
Peptide H-ASGFTFMSSAVQWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLCEILRSMSI-OH
Peptide H-FLCEILRSMSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DDDDDDD-OH
Peptide H-DDDDDDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELRA-OH
Peptide H-AELRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DATNVGDEGGFAPNILENK-OH
Peptide H-DATNVGDEGGFAPNILENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PYNYLSTEV-OH
Peptide H-PYNYLSTEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HMTEVVRHC-OH
Peptide H-HMTEVVRHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HMVYSKRSGKPRGYA-OH
Peptide H-HMVYSKRSGKPRGYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLDLDGIIAEVK-OH
Peptide H-SLDLDGIIAEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VKEFLESSPNTQWELR-OH
Peptide H-VKEFLESSPNTQWELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELTLGEFLKL-OH
Peptide H-ELTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
