Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29635 productos de "Péptidos"
γ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Fórmula:C155H242N40O49SPeso molecular:3,481.96 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O8Peso molecular:882.04 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Fórmula:C107H141N22O37PS2Peso molecular:2,422.53 g/molPre-S1 (12-32)
Catalogue peptide; min. 95% purity
Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molTNF-α(71-82), human
Catalogue peptide; min. 95% purity
Fórmula:C51H91N19O18Peso molecular:1,258.41 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Fórmula:C216H371N75O59S6Peso molecular:5,155.22 g/molMARCKS Substrate (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H246N41O40P3Peso molecular:3,320.78 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Fórmula:C264H426N74O97SPeso molecular:6,220.84 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Fórmula:C35H60N12O7Peso molecular:760.94 g/mol[Val5,Asn9]-Angiotensin I
Catalogue peptide; min. 95% purity
Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molCrustacean Erythrophore Concentrating Hormone
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O11Peso molecular:930.04 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Fórmula:C64H114N22O12Peso molecular:1,383.76 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Fórmula:C49H81N21O17Peso molecular:1,236.32 g/molDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Fórmula:C60H105N21O12Peso molecular:1,312.64 g/molH-His-Arg-OH
CAS:H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Fórmula:C12H21N7O3Pureza:Min. 95%Peso molecular:311.34 g/molRef: 3D-FH108062
Producto descatalogadoAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C185H268N48O51S2Peso molecular:4,044.63 g/mol[Lys0] g-1-MSH, amide
Catalogue peptide; min. 95% purity
Fórmula:C78H109N23O15SPeso molecular:1,640.95 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Fórmula:C8H4BrClK2NO4PPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:402.65 g/molRef: 3D-EB110885
Producto descatalogadoH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C7H12N2O5Pureza:Min. 90 Area-%Forma y color:PowderPeso molecular:204.18 g/molRef: 3D-FA107994
Producto descatalogadoNps-Val-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Producto descatalogadoBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Fórmula:C197H317N59O54S3Peso molecular:4,472.26 g/molMARCKS Protein (151-175)
Catalogue peptide; min. 95% purity
Fórmula:C147H243N41O31Peso molecular:3,080.83 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Fórmula:C52H84N14O21Peso molecular:1,241.33 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Lys0] g-1-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00562.webp&w=3840&q=75)
![[Cys3, 6, Tyr8, Pro10]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00673.webp&w=3840&q=75)
