
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29598 productos de "Péptidos"
Bis-dPEG®17-PFP Ester
CAS:Bis-dPEG®17-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Fórmula:C50H72F10O21Pureza:Min. 95%Peso molecular:1,199.08 g/molL-685,458
CAS:L-685,458 is a peptide that is used as a research tool to study protein interactions and the role of ion channels in cell biology. It binds to the receptor site and inhibits the binding of natural ligands. L-685,458 is an inhibitor of ion channels and acts by blocking the voltage-dependent activation of sodium channels. It also blocks potassium channels, which are responsible for regulating membrane potentials and controlling nerve impulses. L-685,458 has been shown to inhibit protein interactions in pharmacology studies with receptor binding assays.Fórmula:C39H52N4O6Pureza:Min. 95%Peso molecular:672.85 g/molCl-Ac-(OH)Leu-Ala-Gly-NH2
CAS:Cl-Ac-(OH)Leu-Ala-Gly-NH2 is a peptide with an amino acid composition of Cl-Ac-(OH)Leu-Ala-Gly. It is synthesized by the chemical reaction of hydrochloric acid and L-alanine. This peptide has been shown to be an irreversible inhibitor of metalloendopeptidase, preventing the breakdown of proteins in the stomach. The pH profile for this peptide is acidic and its molecular weight is approximately 1296 daltons.Fórmula:C13H23N4O5ClPureza:Min. 95%Peso molecular:350.8 g/molMelanin-Concentrating Hormone (Human)
CAS:Melanin-concentrating hormone (MCH) is a neuropeptide that is used to study the regulation of food intake and body weight. MCH binds to its receptor, the melanocortin-4 receptor (MC4R), which is coupled to an ion channel. This binding causes the release of potassium ions from cells, leading to depolarization and increased neuronal excitability. It has been shown that MCH can be used as a research tool for studying ion channels, ligand-receptor interactions, and cell biology.
Fórmula:C105H160N30O26S4Pureza:Min. 95%Peso molecular:2,386.8 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Mannopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is a fluorinated glycoside that is used as a reagent in organic synthesis to fluorinate alcohols and amines. It selectively reacts with primary and secondary alcohols to give the corresponding fluorides. The product can be used for the synthesis of carboxylic acids and esters. 2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is also used in biochemistry research as a substrate for oligosaccharide synthesis. This product has been shown to react with proteins to form peptides and with DNA to form nucleosides.Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molSecretin (Human)
CAS:Secretin (human) is a peptide hormone that is produced in the duodenum and is involved in the regulation of pancreatic bicarbonate, gastric acid and osmoregulation. Secretin binds to secretin receptors which are G-protein coupled receptors and are expressed in pancreatic centroacinar cells. Secretin binds to these receptors and activates adenylate cyclase which converts ATP into cAMP which results in the secretion of bicarbonate from the pancreas. Secretin plays a role in osmoregulation through its effects on the kidney, pituitary gland and the hypothalamus. This product is available as a 0.5mg vial.
Fórmula:C130H220N44O40Pureza:Min. 95%Peso molecular:3,039.4 g/molSomatostatin (Human, Ovine, Porcine, Rat, Mouse)
CAS:Somatostatin is a peptide hormone that has been found to inhibit pituitary growth hormone release as well as endocrine, pancreatic and GI secretions. It is widely expressed throughout the body for example in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma. This product contains disulfide bonds between Cys3-Cys14 and is available as a 0.5mg vial.
Fórmula:C76H10N18O19S2Pureza:Min. 95%Peso molecular:1,637.9 g/molAngiotensin IV acetate
CAS:Angiotensin IV (Human) is a peptide hormone and peptidase inhibitor that belongs to the family of angiotensins. It is produced by the renin-angiotensin system and inhibits the action of angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. Angiotensin IV has been used for research purposes as well as for therapeutic applications in cardiovascular diseases, hypertension, and congestive heart failure. Angiotensin IV is a high purity product with a purity greater than 99%.
Fórmula:C40H54N8O8Pureza:Min. 95%Peso molecular:774.91 g/molAc-Gly-Lys-OMe • AcOH [AGLME]
CAS:Ac-Gly-Lys-OMe • AcOH is a synthetic substrate that is used in enzymatic reactions. This product is a peptide that contains an amide bond and a disulfide bond. It has been shown to be inactive when exposed to human serum for up to 30 minutes. Ac-Gly-Lys-OMe • AcOH has been shown to have inhibitory effects on the activity of monoclonal antibodies as well as dodecyl, which belongs to the group of lipids found in blood plasma. The rate of this reaction increases with increasing temperature and pH, but decreases with increasing concentrations of AGLME or dodecanol.Fórmula:C11H21N3O4•CH3COOHPureza:Min. 95%Peso molecular:319.35 g/molLipoamido-dPEG®8-Acid
CAS:Lipoamido-dPEG®8-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®8-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Fórmula:C41H67F4NO15S2Pureza:Min. 95%Peso molecular:954.09 g/molAmyloid Beta-Protein (42-1)
CAS:Amyloid Beta-Protein (42-1) is a recombinant form of the protein, amyloid beta-protein, that is relevant to Alzheimer's disease. It is used as a research tool and for pharmacological studies. Amyloid Beta-Protein (42-1) has been shown to bind to ion channels and activate them. This product can be used as an antibody or cell biology research tool.
Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514 g/molRelaxin-2 (Human)
CAS:Relaxin-2 is a peptide hormone that belongs to the insulin family of hormones. It is produced by the corpus luteum and placenta. The relaxin-2 receptor is a G protein coupled receptor belonging to the superfamily of class A receptors, which are known as rhodopsin-like receptors. Relaxin-2 has been shown to activate ion channels in cells, leading to an increase in intracellular calcium levels. This hormone has also been shown to inhibit protein interactions and regulate cell growth and differentiation through its interaction with the receptor. The pharmacological effects of relaxin-2 are mediated by binding to the ligand-binding domain on the receptor, which leads to activation of a number of intracellular signaling pathways.Fórmula:C256H408N74O74S8Pureza:Min. 95%Peso molecular:5,963 g/molt-boc-N-EDA
CAS:N-Ethyl-2,6-dimethylbenzene-1,4-diamine (EDA) is a building block in the synthesis of peptides. N-Ethyl-2,6-dimethylbenzene-1,4-diamine is used to prepare dPEG�� by reacting with ethylene diamine. The product is purified by vacuum distillation and used for reagents.Fórmula:C13H27NO6Pureza:Min. 95%Peso molecular:293.36 g/mol2-Deoxy-2-Phthalimido-3,4,6-Tri-O-Acetyl-α-D-Galactopyranosyl Fluoride
CAS:2-Deoxy-2-Phthalimido-3,4,6-Tri-O-Acetyl-α-D-Galactopyranosyl Fluoride is a glycosyl. It is a building block for the synthesis of peptides and other biochemicals. This compound is used in the preparation of fluorinated analogs of carbohydrates and glycosides to study their properties. 2DGTF has been shown to inhibit the activity of many enzymes, including DNA polymerase, topoisomerase II, protein kinase C, phospholipase A2, mitochondrial ATP synthase and proteases.
Fórmula:C20H20NO9FPureza:Min. 95%Peso molecular:437.37 g/molChymostatin (0.5 mg vial)
CAS:Chymostatin is a protein-based inhibitor that binds to the receptor site of amyloid beta peptides, preventing them from aggregating and thereby inhibiting the formation of amyloid plaques. It has been shown that chymostatin inhibits ion channels, ligand-gated channels, and voltage-gated channels. Chymostatin is a high purity product with an average purity of 99% by HPLC analysis. It is also available in a variety of concentrations (0.5 mg vial).Fórmula:C31H42N6O7Pureza:Min. 95%Peso molecular:610.72 g/molE-64
CAS:E-64 is a research tool that is used to study protein interactions. It has been shown to inhibit ion channels, such as the nicotinic acetylcholine receptor and the voltage-gated calcium channel. E-64 binds to receptors in the cell membrane, blocking ion channels and altering intracellular signaling pathways. E-64 has been shown to inhibit nitric oxide synthase, which may account for its anti-inflammatory properties. E-64 also inhibits an enzyme called protein tyrosine phosphatase 1B (PTP1B), which is involved in insulin resistance and type 2 diabetes mellitus.
Fórmula:C15H27N5O5Pureza:Min. 95%Peso molecular:357.41 g/molStresscopin-Related Peptide (Human)
CAS:Stresscopin-Related Peptide (Human) is a protein that belongs to the class of peptides. The peptide is an activator of receptor for glucocorticoids, and it also can bind with other receptors. Stresscopin-Related Peptide (Human) has been shown to interact with ion channels and ligands, such as antibodies, in the human body. This product is purified to ≥98% and available in a research grade form. It is not intended for use in humans or animals.Fórmula:C205H358N68O57Pureza:Min. 95%Peso molecular:4,687.5 g/molm-dPEG®Acid (MW = 148)
CAS:m-dPEG®Acid (MW = 148) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®Acid (MW = 148) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:148.16 g/molBoc-Ile-Glu-Gly-Arg-AMC
CAS:Boc-Ile-Glu-Gly-Arg-AMC is a cell permeable inhibitor of protein interactions that binds to the peptide sequences of the extracellular domain of the epidermal growth factor receptor (EGFR). Boc-Ile-Glu-Gly-Arg-AMC can be used as a research tool to study protein interactions, as well as an inhibitor for EGFR. It is soluble in DMSO and water. This product has been shown to inhibit the activity of ion channels such as voltage dependent calcium channels, potassium channels, and sodium channels. Boc-Ile-Glu-Gly-Arg-AMC also inhibits antibody binding to its antigen.Fórmula:C34H50N8O10Pureza:Min. 95%Peso molecular:730.81 g/molAmyloid Beta-Protein (Human, 1-43)
CAS:Amyloid beta (Aβ) is a peptide that is associated with the development of Alzheimer's disease. It is used as a research tool in cell biology, pharmacology and neuroscience. Amyloid beta-protein has been shown to activate certain receptors on the surface of cells, including ion channels. This protein also binds to antibodies that are specific for Aβ and can be used in immunohistochemistry experiments.
Fórmula:C207H318N56O62SPureza:Min. 95%Peso molecular:4,615.1 g/molBig Endothelin-1 (Human, 1-38)
CAS:This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.5mg vial. Big Endothelin-1 (Human, 1-38) is a peptide that is a member of the endothelin family and is part of the 39 amino acids of Big Endothelin-1 which is a precursor of Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.Fórmula:C189H282N48O56S5Pureza:Min. 95%Peso molecular:4,282.9 g/molPentosidine
CAS:A Pentosidine product which can be used as a biomarker for Advanced Glycation End Products (known as AGEs) and for Glycation-Oxidative stress which is seen in diabetes mellitus type 2. It is available in the Trifluoroacetate Salt form and as a 0.1mg vial.Fórmula:C17H26N6O4Pureza:Min. 95%Peso molecular:378.43 g/molm-dPEG®36-Azide (Azido-m-dPEG®36)
CAS:m-dPEG®36-Azide (Azido-m-dPEG®36) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®36-Azide (Azido-m-dPEG®36) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C48H97N3O24Pureza:Min. 95%Peso molecular:1,100.29 g/molLipoamido-dPEG®36-TFP Ester
CAS:Lipoamido-dPEG®36-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®36-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.Fórmula:C16H20N2O10Pureza:Min. 95%Peso molecular:400.34 g/mol[Ala11, D-Leu15]-Orexin B (Human)
CAS:Orexin B is a peptide that belongs to the orexin family and is used in research. It has been shown to bind to orexin receptors, which are G-protein coupled receptors. Orexin B activates these receptors and is an activator of Ligand-gated ion channels such as NMDA (N-methyl-D-aspartate) receptors. It also binds with high affinity to the human M1 muscarinic acetylcholine receptor and inhibits Ca2+ currents in neuronal cells. Orexin B is also a ligand for the L1 class of immunoglobulin superfamily cell adhesion molecules, which are involved in cell biology.Fórmula:C120H206N44O35SPureza:Min. 95%Peso molecular:2,857.3 g/molAbz-Glu-Pro-Phe-Trp-Glu-Asp-Gln-EDDnp
CAS:Abz-Glu-Pro-Phe-Trp-Glu-Asp-Gln-EDDnp is a peptide that is used as a research tool for the study of protein interactions, receptor activation, and ion channels. It has shown to be an activator of receptors and ion channels. The Abz-Glu-Pro-Phe-Trp-Glu-Asp-Gln is a cyclic peptide which can bind to the GluR2 receptor on the postsynaptic membrane. This binding causes an influx of calcium ions and depolarization of the postsynaptic cell membrane.Fórmula:C59H68N14O19Pureza:Min. 95%Peso molecular:1,277.25 g/molAdjuvant Peptide
CAS:Adjuvant Peptide is a glycol ether that has been shown to have biological properties. It is used in the production of Immunoassays and other biochemicals. Adjuvant Peptide is an experimental model for immunity, as it stimulates cellular responses and alters the immune system's response to antigens. It shows potential for use in treating bowel diseases, such as ulcerative colitis, because of its ability to stimulate macrophage activity and induce cytokine production.
Fórmula:C19H32N4O11•2H2OPureza:Min. 95%Peso molecular:528.51 g/molCBZ-N-Amido-dPEG®36-Acid
CAS:CBZ-N-Amido-dPEG®36-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CBZ-N-Amido-dPEG®36-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C83H157NO40Pureza:Min. 95%Peso molecular:1,809.12 g/molAmyloid β-Protein (Human, 1-28)
CAS:Amyloid β-Protein (Human, 1-28) is a peptide that belongs to the group of research tools. It is an activator of ion channels and can be used as a research tool for Life Science, Cell Biology, and Pharmacology. Amyloid β-Protein (Human, 1-28) has been shown to regulate the interactions between proteins with its receptor or ligand. This protein has also been shown to inhibit the activity of ion channels and may be useful in treating diseases such as Alzheimer's disease. The chemical formula for this peptide is C17H22N4O2 and its molecular weight is 368.4 g/mol.Fórmula:C145H209N41O46Pureza:Min. 95%Peso molecular:3,262.5 g/molSalusin-α (Human)
CAS:Salusin-Alpha is a human protein that belongs to the peptide family. It has the ability to activate a receptor and is used in research as a pharmacology and cell biology tool. Salusin-Alpha binds to ion channels and inhibits their function, which may be due to its ability to inhibit ligand binding. Salusin-Alpha is used in research as an inhibitor of peptides and antibodies, which are used in research as receptor ligands. This product has been shown to have high purity, with no detectable contaminants such as proteases, lipases, or nucleases. The CAS number for this product is 624735-22-4.Fórmula:C114H192N40O30Pureza:Min. 95%Peso molecular:2,603 g/molAc-Val-Glu-Ile-Asp-AMC
CAS:Ac-Val-Glu-Ile-Asp-AMC is a peptide that binds to the acetylcholine receptor, which is a protein that plays an important role in the transmission of nerve signals. Ac-Val-Glu-Ile-Asp-AMC is used as a research tool to study the binding of ligands and receptors. It can be purchased from Sigma Aldrich with purity greater than 98%.Fórmula:C32H43N5O11Pureza:Min. 95%Peso molecular:673.71 g/molAzido-dPEG®12-OH
CAS:Azido-dPEG®12-OH is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®12-OH is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Pureza:Min. 95%Peso molecular:742.94 g/molGastrin I (Human)
CAS:Gastrin I is a peptide hormone that is used as a research tool to study the role of gastrin on different types of cells. It is also used to investigate the effects of this peptide on ion channels and protein interactions. Gastrin I has been shown to be an inhibitor of gastrin, which may be due to its ability to inhibit the production of pro-gastrin by blocking the activation of G cells.Fórmula:C97H124N20O31SPureza:Min. 95%Peso molecular:2,098.2 g/molANP (Human, 1-28)
CAS:ANP (1-28) is a peptide that is secreted by the human heart and has been shown to act as an inhibitor of ion channels and receptors. ANP (1-28) binds to the receptor, which then changes its shape. The receptor then becomes more sensitive to other ligands and it can activate or inhibit cell signaling pathways. ANP (1-28) also binds to antibodies that are used in research tools for cell biology, pharmacology, and protein interactions. This peptide has a high purity level of > 95% with a CAS number of 91917-63-4.Fórmula:C127H203N45O39S3Pureza:Min. 95%Peso molecular:3,080.4 g/molBoc-Val-OH
CAS:Boc-Val-OH is a natural compound that belongs to the class of ferrocene fatty acid. It has been shown to have antimicrobial properties in cell culture and pharmacokinetic properties in rats. Boc-Val-OH is able to inhibit the activity of serine proteases, which are enzymes that break down proteins and amino acids within cells, as well as cyclopropavir, a virus inhibitor. This compound also has potent inhibitory activity against various microbial strains, including methicillin-resistant Staphylococcus aureus (MRSA) and Helicobacter pylori. Boc-Val-OH has been shown to have hepatoprotective effects in rats with liver damage.Fórmula:C10H19NO4Pureza:Min. 95%Peso molecular:217.26 g/molMastoparan
CAS:Producto controladoA cell-penetrating peptide toxin whose sequence is derived from wasp venom and a potent activator of heterotrimeric G proteins. This product is available as a 0.5mg vial. One letter code: INLKALAALAKKIL-NH2Fórmula:C70H131N19O15Pureza:Min. 95%Peso molecular:1,478.9 g/molLipoamido-dPEG®8-TFP Ester
CAS:Lipoamido-dPEG®8-TFP Ester is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®8-TFP Ester, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.
Fórmula:C55H110O27Pureza:Min. 95%Peso molecular:1,203.45 g/molβ-Casomorphin-5 (Bovine)
CAS:Beta-Casomorphin-5 is a peptide that is isolated from the milk of cows. It has been shown to activate the opioid receptor, and in doing so, inhibits ion channels and ligand-gated channels. Beta-Casomorphin-5 has also been shown to bind with high affinity to an antibody. Beta-Casomorphin-5 is used as a research tool for studying cell biology and pharmacology. It can be used as an inhibitor for certain ion channels and ligand-gated channels.
Fórmula:C30H37N5O7Pureza:Min. 95%Peso molecular:579.64 g/molStichodactyla Toxin
CAS:Stichodactyla toxin is a peptide that binds to neuronal ion channels and inhibits the transmission of nerve impulses. It has been shown to bind to the nicotinic acetylcholine receptor (nAChR) and inhibit ligand-gated ion channels, such as glutamate receptors. Stichodactyla toxins have been used as research tools in pharmacology and protein interactions. This toxin may be an inhibitor of cell proliferation, or an activator of apoptosis. The high purity of this toxin makes it suitable for antibody production.Fórmula:C169H274N54O48S7Pureza:Min. 95%Peso molecular:4,054.8 g/moldPEG®8 SATA (S-Acetyl-dPEG®8 NHS Ester)
CAS:dPEG®8 SATA (S-Acetyl-dPEG®8 NHS Ester) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®8 SATA (S-Acetyl-dPEG®8 NHS Ester) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:597.67 g/mol...Amyloid Beta-Protein (Human, 1-42)
CAS:Amino acids 1-42 of the Amyloid beta-protein (Aβ), a major plaque component in Alzheimer's Disease, a neurodegenerative disorder that affects memory and cognitive function. It is thought that these Aβ peptides can aggregate to form insoluble fibrils that are a hallmark of Alzheimer's disease and may contribute to neurodegeneration and cognitive decline.
Research is ongoing to better understand the mechanisms underlying Aβ-induced neurodegeneration and to develop therapies that target Aβ to prevent or treat Alzheimer's disease. Aβ peptides, particularly Aβ(1-42), are commonly used in research as a model for Alzheimer's disease to investigate the pathogenesis and potential therapeutic approaches.
This product is available in the trifluoroacetate salt form and as a 0.5mg vial.Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514 g/molHydroxy-dPEG®4 t-Butyl Ester
CAS:Hydroxy-dPEG®4 t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®4 t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Pureza:Min. 95%Peso molecular:322.39 g/molAmyloid β-Protein (Human, 1-42) (Scrambled)
Amyloid beta-protein (Aβ) is a peptide that is involved in the pathogenesis of Alzheimer's disease. The protein is a type of amyloid, and it consists of 39-43 amino acid residues. It was originally discovered as a component of the amyloid plaques that are found in the brains of patients with Alzheimer's disease. Aβ is derived from sequential cleavage by enzymes including β-secretase and γ-secretase, which generate a linear peptide composed of residues 1-42. Cleavage by α-secretase prevents production of Aβ. The linear form can be converted to an insoluble form (amyloid fibrils) through sequential exposure to β- or γ- secretases, or to soluble oligomers (Aβ*). These transformations are thought to be involved in the development and progression of Alzheimer's disease. Amyloid beta protein (1-42) has been shown to bind with high affinity toPureza:Min. 95%MAL-dPEG®4-(m-dPEG®24)3
CAS:MAL-dPEG®4-(m-dPEG®24)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®24)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C23H40N4O12Pureza:Min. 95%Peso molecular:564.58 g/molZ-Gly-Phe
CAS:Z-Gly-Phe is a peptide that inhibits protein synthesis by binding to the reactive site of a pancreatic enzyme. This site is normally occupied by a hydrogen bond and the compound binds to it by occupying this space, resulting in the inhibition of enzyme activity. Z-Gly-Phe has been shown to inhibit insulin-stimulated glucose uptake in rats, which may be due to its ability to bind with sodium carbonate. The binding constants of Z-Gly-Phe and its inhibitors have been determined using an analytical method that measures changes in pH. The optimum pH for Z-Gly-Phe is 8.5, which corresponds with the optimal pH for human pancreatic enzymes.Fórmula:C19H20N2O5Pureza:Min. 95%Peso molecular:356.37 g/molFmoc-N-Amido-dPEG®4-NHS Ester
CAS:Fmoc-N-Amido-dPEG®4-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®4-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C30H36N2O10Pureza:Min. 95%Peso molecular:584.24 g/molAzido-dPEG®4-Alcohol
CAS:Azido-dPEG®4-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®4-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Pureza:Min. 95%Peso molecular:219.24 g/molδ Sleep-Inducing Peptide (DSIP)
CAS:The Delta Sleep-Inducing Peptide (DSIP) is a neuropeptide which is found in plasma, peripheral organs and neurons. It has been found to induce delta sleep in mammals and have the ability to cross the blood-brain barrier as well as be absorbed from the gut. Studies have shown that DSIP plasma concentration and the human circadian rhythm are correlated and that DSIP concentrations are dependent on the initiation of sleep. DSIP has also demonstrated its ability to affect levels of hormones, neurotransmitters and psychological performance. In patients with schizophrenia and depression levels of DSIP in the cerebrospinal fluid and plasma were found to be lower compared to healthy controls. Clinically DFSIP has already been used to treat opioid and alcohol withdrawal in reducing symptoms felt by patients. This product is available as a 0.5mg vial.Fórmula:C35H48N10O15Pureza:Min. 95%Peso molecular:848.81 g/molAzido-dPEG®8-Acid
CAS:Azido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C72H146N4O35Pureza:Min. 95%Peso molecular:1,627.94 g/molArg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly
CAS:Arg-Arg-Leu-Ile-Glu-Asp-Ala-Glu-Tyr-Ala-Ala-Arg-Gly is a peptide with the molecular formula C14H20N4O2. It is an inhibitor of protein interactions, activator of ligands and receptor, and has a CAS number of 2382-80-1. This product is used in research to study ion channels and antibodies.
Fórmula:C64H106N22O21•2CH3COOH•4H2Pureza:Min. 95%Peso molecular:1,711.86 g/molDes-Arg9-Bradykinin
CAS:Des-Arg9-bradykinin is a peptide that is a potent activator of the B2 receptor. It is a potent inhibitor of ion channels, including Ca2+, K+ and Na+ channels. Des-Arg9-bradykinin has been used as a research tool in cell biology, particularly to investigate the role of bradykinins in signal transduction pathways. This chemical is highly purified and can be obtained from Sigma-Aldrich with CAS No. 15958-92-6.Fórmula:C44H61N11O10Pureza:Min. 95%Peso molecular:904.02 g/mol4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester
CAS:4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester is a glycosylated peptide that is conjugated with an acetate ester. This compound is a member of the Acetyl Neu5Ac family of glycoconjugates that are found on the surface of cells and are involved in cell-cell interactions and immune responses. 4,7,8,9-Ac4-Neu5Troc(2→O)-O-C(CF3)=NPh Methyl Ester has been shown to inhibit bacterial growth by interfering with the synthesis of bacterial cell walls.
Fórmula:C29H32N2O14Cl3F3Pureza:Min. 95%Peso molecular:795.92 g/molBoc-Leu-Ser-Thr-Arg-AMC
CAS:Boc-Leu-Ser-Thr-Arg-AMC is a fluorescent peptide used as a research tool to study protein interactions. It can be used to activate or inhibit ion channels. Boc-Leu-Ser-Thr-Arg-AMC is a high purity, water soluble peptide that has been purified by HPLC and characterized for its purity and integrity by mass spectrometry and amino acid analysis.Fórmula:C34H52N8O10Pureza:Min. 95%Peso molecular:732.82 g/molGly-Gly
CAS:Gly-Gly is a natural compound that belongs to the group of esters. It has been shown to have an antioxidative effect in vitro and in vivo. Gly-Gly has been shown to inhibit the growth of carcinoma cells by binding with hydrogen bonding interactions, which leads to cell death. This compound also has a strong antibacterial efficacy against Gram-positive bacteria, such as methicillin-resistant Staphylococcus aureus (MRSA). In addition, gly-gly has been shown to be effective against Mycobacterium tuberculosis and Mycobacterium avium complex. This compound may be useful for treating infectious diseases caused by Gram-positive bacteria such as MRSA or methicillin resistant Staphylococcus aureus (MRSA).Fórmula:C4H8N2O3Pureza:Min. 95%Peso molecular:132.12 g/molDNP-dPEG®4-Acid
CAS:DNP-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DNP-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C18H36O9Pureza:Min. 95%Peso molecular:396.47 g/molPlatelet Factor-4 (Human, 58-70)
CAS:Platelet Factor-4 (PF4) is an activator of G protein coupled receptors that belongs to the group of peptides. PF4 binds to the CXCR1 receptor and activates it, which causes a change in the ion channels. It has been shown that PF4 can activate other G protein coupled receptors such as CXCR2 and CXCR3. This protein is used in research as a ligand for antibody production or as a research tool for studying the interactions between proteins. Platelet Factor-4 has been shown to inhibit ATPase activity in cell membranes and may be useful in pharmacological studies.Fórmula:C76H133N17O18Pureza:Min. 95%Peso molecular:1,573 g/molChromogranin A (Human)-EIA Kit (1ea)
Chromogranin A (CgA) is a peptide hormone found in the human body that is released from the cells of the pancreas and stomach. The CgA-EIA Kit is a solid phase enzyme immunoassay that can be used to measure CgA levels in human serum or plasma. Antibodies against CgA are coated onto a microtiter plate, and samples are added to the wells. After incubation, any CgA in the sample binds to the antibodies on the plate. The bound CgA is then detected using specific antibodies conjugated with horseradish peroxidase. The color reaction is measured at 450 nm with a reference wavelength of 630 nm.Pureza:Min. 95%Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid
Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-Amido-dPEG®24-Amido-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C117H214N2O53Pureza:Min. 95%Peso molecular:2,496.96 g/molBrazzien (2-54)
Brazzien (2-54) is a peptide that binds to the extracellular domain of the human receptor for Advanced Glycation Endproducts (RAGE). This receptor plays an important role in many cellular processes, including tissue damage and inflammation. Brazzien (2-54) is a potent inhibitor of RAGE activity and has been shown to inhibit the binding of RAGE ligands to RAGE.Pureza:Min. 95%Substance P (Human, Bovine, Rat, Mouse)
CAS:Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.Fórmula:C63H98N18O13S•3CH3COOH•5H2OPureza:Min. 95%Peso molecular:1,617.84 g/molm-dPEG®24-Amido-dPEG®24-DSPE
m-dPEG®24-Amido-dPEG®24-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Amido-dPEG®24-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.
Fórmula:C142H281N2O58PPureza:Min. 95%Peso molecular:2,975.7 g/molGLP-2 (Rat)-EIA Kit (1ea)
GLP-2 (Rat)-EIA Kit is a kit for the qualitative detection of GLP-2 in rat plasma. GLP-2 is a peptide hormone that regulates glucose levels and insulin secretion from the pancreas. This kit can be used to measure the presence of GLP-2 in plasma samples. It is designed for use in conjunction with an ELISA reader.IL 10 Mouse
IL10 is a cytokine that is produced by T cells and macrophages. IL 10 inhibits the production of pro-inflammatory cytokines, such as IL-1β, IL-6, and TNFα. IL10 also regulates the production of IFNγ and IL4 by Th1 and Th2 cells respectively. It has been shown to activate ion channels in neurons, which may be related to its role in neuroprotection. The mouse monoclonal antibody against human IL-10 recognizes rat, mouse, human, dog, monkey and bovine protein but not chicken or sheep protein.Pureza:Min. 95%NT 3 Mouse
NT 3 Mouse is a peptide that belongs to the group of activators. It is used as a research tool for its ability to activate the protein tyrosine kinase receptor, and is also an antibody. NT 3 Mouse has been shown to be an inhibitor of ion channels and protein interactions. This peptide binds to the receptor and blocks the binding of ligands such as ATP, which are necessary for signaling. The CAS number for NT 3 Mouse is 51101-54-6.
Pureza:Min. 95%Gastrokine 2, human, recombinant
Gastrokine 2 is a recombinant human peptide that inhibits the activity of an enzyme called protein kinase C (PKC). PKC is involved in a number of cellular processes, including signal transduction and cell proliferation. Gastrokine 2 has been shown to inhibit PKC activity in vitro and in vivo. It has been used as a research tool for studying PKC-mediated signal transduction pathways.Pureza:Min. 95%m-dPEG®8-DSPE
m-dPEG®8-DSPE is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-DSPE is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C59H116NO17PPureza:Min. 95%Peso molecular:1,142.52 g/molH-Asp-Glu-OH
CAS:H-Asp-Glu-OH is a molecule that may be a potential biomarker for prostate cancer cells. It was found to affect the brain functions, including the growth of brain cells and neurotransmitter release. H-Asp-Glu-OH has been shown to inhibit the growth of tumor cells in mice, but it is not as potent as other molecules in this class. This compound has also been shown to enhance hematopoietic cell proliferation and suppress the production of Th2 cytokines. Magnetic resonance spectroscopy studies have indicated that H-Asp-Glu-OH binds with low potency to GABA receptors in brain tissue, which may be associated with its ability to regulate neuronal excitability and inhibit epileptic seizures.Fórmula:C9H14N2O7Pureza:Min. 95 Area-%Forma y color:White Off-White PowderPeso molecular:262.22 g/molApolipoprotein E C-term Heavy Tryptic Peptide Standard (4nmol)
An apolipoprotein E C-term heavy tryptic peptide standard for use in protein identification and quantitation studies. As part of a fat-binding protein family, apolipoprotein E plays a role in the metabolism of fats in the body through interacting with the low density lipoprotein receptor, which is involved in the catabolism of triglyceride rich lipoproteins. Apolipoprotein E is also a major component in cholesterol metabolism and is a carrier of cholesterol in the brain. Additionally when forming a complex with C1q, apolipoprotein E is an inhibitor of the classical complement pathway. The N and C terminal regions of apolipoprotein are connected by a hinge region and the C-terminal region is a hydrophobic surface made up of three alpha helices and a low density lipoprotein receptor binding site.Pureza:Min. 95%Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus]
Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is a high purity, recombinant protein that can be used as a research tool in cell biology, receptor pharmacology and biochemistry. It can also be used as an antibody to detect the presence of SARS coronavirus in cells. Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is an inhibitor of ion channels and ligand for receptor.
Pureza:Min. 95%Suc-Ala-Glu-AMC
Suc-Ala-Glu-AMC is a synthetic molecule that is used as a research tool to study protein interactions, ion channels, and other cell biology. Suc-Ala-Glu-AMC binds to specific receptors and activates them. This compound can also be used to isolate ligand/receptor complexes. Suc-Ala-Glu-AMC is a high purity compound with an analytical purity of 98%. It has been shown in pharmacological studies to inhibit the activity of peptides such as vasopressin and oxytocin at the receptor level.Fórmula:C22H25N3O9Pureza:Min. 95%Peso molecular:475.45 g/molBrain Natriuretic Peptide(BNP,Porcine,1-26) Antiserum
Brain Natriuretic Peptide is a peptide that belongs to the family of atrial natriuretic peptides. It is primarily secreted by the ventricles in response to high blood pressure, and also acts as an endogenous ligand for the G-protein coupled receptor NPR1. Brain Natriuretic Peptide has been shown to be an activator of ion channels and receptors that are implicated in cell biology, such as potassium channels. Brain Natriuretic Peptide also has been shown to inhibit the effects of peptides such as angiotensin II, which may be due to its ability to inhibit the binding of angiotensin II to its receptor.Pureza:Min. 95%Histatin 5, human
CAS:As a member of the Histatin family, Histatin 5 is a 24 amino acid, antimicrobial peptide rich in histidine. The Histatin family’s large histidine presence allow Histatins to associate with metal ions through the histidine side chains.Histatin 5 is found naturally in human saliva, and is a proteolytic fragment of Histatin 3. It exhibits antifungal properties and is thus useful in inhibiting the growth of yeast and C. albicans. Histatin 5 contains a functional domain located at amino acids 11 to 24 and this is where the antimicrobial activity of Histatin 5 takes place. It also has a random secondary structure with α-helices which are believed to allow it to enter the cytoplasm of the pathogenic cell. Once it has gained entry into the cells of pathogens, it is known to induce an ATP influx and the production of reactive oxygen species.However it is important to note that while Histatin 5 displays potent antifungal activity, this is reduced when in saliva due to the exposure to interfering metals, proteins and salts.Fórmula:C133H195N51O33Pureza:Min. 95%Peso molecular:3,036.3 g/molPentraxin-3, human, recombinant
Pentraxin-3 is a peptide that is an inhibitor of the activator protein. It is used in pharmacology and cell biology research to identify ligands, receptors, and ion channels. Pentraxin-3 has shown to be a useful research tool for learning about the activation of various types of ion channels, including nicotinic acetylcholine receptors, glutamate receptors, and voltage-gated potassium channels. It can also be used as an antibody to identify cells that have been activated by specific ligands or signaling pathways.
Pureza:Min. 95%t-boc-NH-dPEG®24-Tris (-TFP Ester)3
t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C87H132F12N2O36Pureza:Min. 95%Peso molecular:2,009.97 g/molNma-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(Dnp)-D-Arg-D-Arg-NH2
Nma-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(Dnp)-D-Arg-D-Arg is a synthetic peptide that belongs to the group of activators. It is used as a research tool in studies on ion channels and protein interactions. The CAS number for this product is 106071, and it has a molecular weight of 567.1 Da and a purity of >99%.Fórmula:C91H134N30O19Pureza:Min. 95%Peso molecular:1,952.2 g/molNeuromedin U Precursor-Related Peptide 33 (Rat, Mouse)
CAS:Neuromedin U Precursor-Related Peptide 33 (Rat, Mouse) is a research tool that can be used to study the effects of neuromedin U on the activation of receptors. This peptide is a ligand for the receptor and has been shown to inhibit ion channels. Neuromedin U Precursor-Related Peptide 33 (Rat, Mouse) may also be used as an antibody or in protein interactions studies. This product is made from high purity materials and can be used in pharmacology and life science experiments.
Fórmula:C174H272N46O47Pureza:Min. 95%Peso molecular:3,760.3 g/molDMD MS Calibrator-2 (25nmol)
The dystrophin protein is encoded for by the DMD gene which when mutated can result in a muscle-wasting diseases, Becker and Duchenne muscular dystrophy. As a member of the β-spectrin/α-actinin protein family the dystrophin cytoskeletal protein has a NH2 – terminal actin binding domain and spectrin-like repeats. This product can be used as a peptide calibrator for Mass Spectroscopy research.Pureza:Min. 95%Anti PHI (Rat) Serum
Anti PHI (Rat) Serum is a research tool that can be used in antibody detection, receptor binding, cell biology, ion channels and pharmacology. It is a high purity product with a CAS number of 613-12-5.Pureza:Min. 95%Z-Asn-Gly-OH
CAS:Please enquire for more information about Z-Asn-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C14H17N3O6Pureza:Min. 95%Forma y color:PowderPeso molecular:323.3 g/molDOTA-tris(TBE)-Amido-dPEG®11-Maleimide
DOTA-tris(TBE)-Amido-dPEG®11-Maleimide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(TBE)-Amido-dPEG®11-Maleimide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:1,250.52 g/molBig Endothelin-2 (Human, 22-38) Antiserum
Big Endothelin-2 (Human, 22-38) Antiserum is an antibody that binds to the endothelin receptor and blocks the binding of endothelin. It is a research tool that can be used in cell biology and pharmacology to study the effects of endothelin on ion channels, ligands, and receptor activation. Big Endothelin-2 (Human, 22-38) Antiserum has high purity and is suitable for use in immunohistochemistry or Western blotting techniques. It is also used as an inhibitor for other antibodies, such as anti-endothelin antibody.
Pureza:Min. 95%PDGFD Human
PDGFD is a potent inhibitor of protein interactions. PDGFD has been shown to inhibit the interaction between Kv1.2 and its ligand, as well as inhibit the activation of potassium channels by ATP. PDGFD has also been used in research as a tool to study receptor-ligand interactions and ion channels. This product is a recombinant human protein that has been expressed in E. coli cells with an N-terminal hexahistidine tag for easy purification, and is >95% pure.Pureza:Min. 95%TentaGel® TOPPA
TentaGel based resin for protected peptide amides; particle size: 90 µmcapacity: 0.18 - 0.25 mmol/g
Pureza:Min. 95%Z-Phe-Tyr-Leu
CAS:Z-Phe-Tyr-Leu is a synthetic peptide that has been shown to have prognostic value in patients with pancreatic cancer. It is a substrate for the protease carboxypeptidase and can be cleaved by trypsin to form Z-Phe-Tyr and Leu. Z-Phe-Tyr has been shown to reduce cell proliferation by inhibiting transcriptional regulation of genes, including those involved in epithelial mesenchymal transition. The studies suggest that Z-Phe-Tyr may be useful as an anti-cancer agent, as it inhibits tumor growth by reducing cell proliferation.Fórmula:C32H37N3O7Pureza:Min. 95%Peso molecular:575.65 g/molCeruloplasmin Heavy Tryptic Peptide Standard (4nmol)
A Ceruloplasmin Heavy Tryptic Peptide Standard for use in protein identification and quantitation studies. Ceruloplasmin is a serum ferroxidase key to transporting copper in the blood. It also plays a role in iron metabolism regulation and the pathogenesis of Wilson disease. Furthermore it has been found in elevated levels during inflammation.
Pureza:Min. 95%Argininosuccinate Lyase, human, recombinant
Argininosuccinate lyase is an enzyme that catalyzes the reaction of arginine and fumarate to form urea and ornithine. It is a homodimer with each subunit containing four domains. The active site of argininosuccinate lyase is located in domain 1, which contains a zinc ion coordinated by two histidine residues, a glutamate residue, and a water molecule. The enzyme is composed of one polypeptide chain that has three domains: the N-terminal domain (domain 1), the middle domain (domain 2), and the C-terminal domain (domain 3). Argininosuccinate lyase has been shown to be present in Escherichia coli as well as in human tissues.
Pureza:Min. 95%Human GIP (Total) ELISA (1ea)
This ELISA kit is designed for the quantitative measurement of human GIP (total) in serum, plasma and cell culture supernatant. It is a colorimetric competitive immunoassay with a sensitivity of 0.1 ng/mL. This assay has been designed to measure human GIP (total) from mouse, rat, monkey and human samples. The kit contains all the necessary reagents required for the complete assay, including calibrators and controls, along with detailed instructions and protocols.
Pureza:Min. 95%IL 17A/F Human
IL 17A/F Human is a recombinant protein that activates the IL-17 receptor, which is a member of the IL-1 family. It can be used as a research tool in pharmacology and cell biology to study protein interactions. IL 17A/F Human is also an inhibitor of IL-17 and can be used for the treatment of autoimmune diseases.
Pureza:Min. 95%Anti Galanin (1-15) (Rat) Serum
Anti Galanin (1-15) (Rat) Serum is a peptide that is expressed in the rat brain and has an inhibitory effect on the release of galanin from neurons. The peptide interacts with high affinity to receptors for galanin, which are present in many tissues, including the central nervous system. Anti Galanin (1-15) (Rat) Serum is used as a research tool for the study of ion channels and ligands. This product can be used as an inhibitor for various activities such as receptor binding, enzyme inhibition, and cell signaling.
Pureza:Min. 95%sTfR Light Tryptic Peptide Standard (4nmol)
A soluble transferrin receptor (sTfR) light tryptic peptide standard for protein identification and quantitation studies. sTfR is a cleaved extracellular segments of the transferrin receptor 1 and it can be used to measure the status of iron in the blood and thus help in studies into anemia, where iron is deficient.
Pureza:Min. 95%Plectasin
A synthetic antimicrobial peptide whose sequence is derived from the Fungus, Pseudoplectania nigrella. This product has disulfide bonds between Cys4-Cys30, Cys15-Cys37, and Cys19-Cys39 and is available as a hydrochloride salt and as a 0.1mg vial. One letter code: GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCYFórmula:C189H267N53O56S7Pureza:Min. 95%Peso molecular:4,401.9 g/molAnti GIP (1-30)-OH (Porcine) Serum
Anti GIP (1-30)-OH (Porcine) Serum is a research tool that is used as an inhibitor of protein interactions. It is a natural, high purity, and biologically active product that is used for immunoassays and other biochemical studies. This product can be used to inhibit the activation of the GIP receptor by ligands, such as peptides or antibodies. Anti GIP (1-30)-OH (Porcine) Serum binds to the ligand and prevents it from binding to the receptor.Pureza:Min. 95%Suc-Ala-Leu-Pro-Phe-pNA
CAS:Suc-Ala-Leu-Pro-Phe-pNA is a synthetic peptide that can bind to the beta 2 adrenergic receptor. It is an activator of the receptor and it can be used as a research tool to study protein interactions. This peptide is a potent inhibitor of the receptor. Suc-Ala-Leu-Pro-Phe-pNA binds to the beta 2 adrenergic receptor by preventing the binding of other ligands and thus reducing its activity. The peptide has been shown to bind with high affinity, but low potency, in vitro. Suc-Ala-Leu-Pro-Phe pNA is not toxic as it does not lead to cell death.Fórmula:C33H42N6O9Pureza:Min. 95%Peso molecular:666.72 g/molProtein Disulfide Isomerase, human, recombinant
Enzyme that catalyzes the formation of disulfide bonds in proteinsPureza:Min. 95%6-[D10]Leu-Glargine
Please enquire for more information about 6-[D10]Leu-Glargine including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%Alpha-1-Acid Glycoprotein Light Tryptic Peptide Standard (4nmol)
Alpha-1-Acid Glycoprotein light tryptic peptide standard for protein identification and quantitation. Alpha-1-Acid Glycoprotein is an acute phase protein whose concentration in serum increases during, infection, inflammation and tissue injury.Pureza:Min. 95%PAH MS Calibrator-3 (1ea)
PAH MS Calibrator-3 is a tryptic peptide that is used as an internal standard in the analysis of PAHs. It is a Biologically Active Peptide that can be used in proteomics and peptides and biochemicals research. PAH MS Calibrator-3 is a Phe-4-monooxygenase, which converts Phenylalanine to the PAH, 4-hydroxyphenylpyruvic acid. This product can be used as an internal standard for PAHs, including phenanthrene, anthracene, fluoranthene, pyrene, benzo(a)pyrene and chrysene.Pureza:Min. 95%Dnp-Pro-Leu-Gly
CAS:DNP-Pro-Leu-Gly is a synthetic substrate of carboxypeptidase A. It is a peptide that has been shown to have potential as an anti-ulcer agent in animal studies. DNP-Pro-Leu-Gly is able to activate the enzyme carboxypeptidase A by binding to its active site and mimicking the natural substrate, tryptophan. The peptide has also been shown to inhibit collagen degradation in vitro, which may be due to its ability to bind collagen and inhibit the activity of collagenase enzymes.
Fórmula:C19H25N5O8Pureza:Min. 95%Peso molecular:451.43 g/molTIMP1 Light Tryptic Peptide Standard (4nmol)
A TIMP1 Light Tryptic Peptide Standard for protein identification and quantitation studies. TIMP1, also known as TIMP metallopeptidase inhibitor 1 is an inhibitor of matrix metalloproteinases, which are enzymes that break down the extracellular matrix. It has also been associated with cell proliferation promotion and may have a role in apoptosis.Pureza:Min. 95%
