Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30318 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
D-loop peptide, synthetic
CAS:D-loop peptide, synthetic; antigenic; cycles via Asp10 side chain to terminal amide bond.Fórmula:C53H76N16O16SPureza:98%Forma y color:SolidPeso molecular:1225.35Leu-Val
CAS:Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Fórmula:C11H22N2O3Pureza:99.32%Forma y color:SolidPeso molecular:230.3[Pro3]-GIP (Mouse) acetate
[Pro3]-GIP (Mouse) acetate is mouse [Pro3]-GIP. [Pro3]-GIP is a GIP receptor antagonist.Fórmula:C227H346N62O66SPureza:95.31%Forma y color:SoildPeso molecular:5028.53Gly-Phe-Arg
CAS:Gly-Phe-Arg is a highly potent synthetic tripeptide that mimics the pumping pheromone of the mud-crab.Fórmula:C17H26N6O4Pureza:98%Forma y color:SolidPeso molecular:378.43Bam 12P acetate
Bam 12P acetate is the putative enkephalin precursor in bovine adrenal, pituitary, and hypothalamus.Fórmula:C64H101N21O18SPureza:98.84%Forma y color:SolidPeso molecular:1484.68Nictide
CAS:<p>Nictide, a peptide substrate for LRRK2 (leucine-rich repeat protein kinase-2), undergoes phosphorylation by the activated form of LRRK2[G2019S], exhibiting a Km value of 10 μM.</p>Fórmula:C123H193N45O28Forma y color:SolidPeso molecular:2750.13RO7196472
CAS:RO7196472 is a potent macrocyclic peptide antibiotic that selectively inhibits the activity of Acinetobacter strains. It targets the lipopolysaccharide (LPS) binding site on the inner membrane's LptB2FG complex, inhibiting lipopolysaccharide transport and thereby suppressing the activity of Acinetobacter strains.Fórmula:C41H49ClN10O3SForma y color:SolidPeso molecular:797.41His-Pro hydrochloride
His-Pro hydrochloride is a dipeptide consisting of histidyl and proline.Fórmula:C11H17ClN4O3Pureza:98%Forma y color:SolidPeso molecular:288.73HEX3
CAS:HEX3 is a truncated form of the adenoviral hexon, which serves as the primary capsid protein for adenovirions.Fórmula:C47H78N12O14Pureza:98%Forma y color:SolidPeso molecular:454.06POT-4 acetate
<p>POT-4 acetate inhibits Complement C3 activation. POT-4 acetate can be used for studies about age-related macular degeneration.</p>Fórmula:C74H106N22O20S2Pureza:98%Forma y color:SolidPeso molecular:1687.9M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Fórmula:C70H91N15O27Pureza:98%Forma y color:SolidPeso molecular:1574.56Nph-peptide
CAS:Nph-peptide can be used for photoaffinity labeling of the N-formyl peptide receptor site of intact human polymorphonuclear leukocytes.Fórmula:C55H78N12O12Pureza:98%Forma y color:SolidPeso molecular:1099.28TKD (450-463)
CAS:TKD (450-463), a 14-peptide (TKDNNLLGRFELSG), exhibits the ability to stimulate NK cells' cytolytic and proliferative activities at concentrations comparable to the full-length Hsp70 protein.Fórmula:C67H110N20O23Forma y color:SolidPeso molecular:1563.71RO27-3225 TFA (274682-89-2 free base)
RO27-3225 TFA: potent MC4R agonist (EC50: 1 nM), 30x more selective than MC3R, neuroprotective, anti-inflammatory.Fórmula:C41H53F3N12O8Pureza:98%Forma y color:SolidPeso molecular:898.93Cholecystokinin pentapeptide
CAS:Cholecystokinin pentapeptide is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.Fórmula:C31H39N7O7SPureza:98%Forma y color:SolidPeso molecular:653.75BDC2.5 mimotope 1040-31
CAS:<p>Mimotope 1040-31 agonizes diabetogenic BDC2.5 T-cells, specifically targets BDC2.5 TCR Tg+ cells, known as p31.</p>Fórmula:C63H97N17O14SPureza:98%Forma y color:SolidPeso molecular:1348.61OVA G4 peptide
CAS:G4 peptide (SIIGFEKL), a variant of ovalbumin epitope SIINFEKL, binds to mouse MHC class I H-2Kb.Fórmula:C43H71N9O12Pureza:98%Forma y color:SolidPeso molecular:906.08HIV-1 TAT 48-60
HIV-1 TAT (48-60) is a cell-penetrating peptide from HIV-1 Tat protein residues 48-60.Fórmula:C70H131N35O16Pureza:98%Forma y color:SolidPeso molecular:1719Acetyl decapeptide-3
CAS:Acetyl decapeptide-3 is a peptide that can stimulate collagen and elastin to increase skin elasticity and increase cell growth and improve healing and repair.Fórmula:C68H95N19O17Pureza:98%Forma y color:SolidPeso molecular:1450.6Laminin B1 octapeptide P-8
CAS:Laminin B1 octapeptide P-8 is a synthetic laminin B1 chain octapeptide with laminin receptor binding ability.Fórmula:C43H67N13O15Pureza:98%Forma y color:SolidPeso molecular:1006.07Acetyl-PHF6 amide(TFA) (878663-43-5 free base)
Acetyl-PHF6 amide TFA is a tau derived hexapeptide.Fórmula:C40H64F3N9O11Pureza:98%Forma y color:SolidPeso molecular:903.99Lipoxygenase
CAS:Lipoxygenase (LOX) is a dioxygenase that catalyzes the peroxidation of linoleic acid (LA) or arachidonic acid (AA) in the presence of molecular oxygen.Forma y color:SolidTNF-α (31-45), human TFA (144796-71-4 free base)
<p>TNF-α (31-45), human (TFA) is a peptide of tumor necrosis factor-α.</p>Fórmula:C71H123F3N26O24Pureza:98%Forma y color:SolidPeso molecular:1781.89FALGPA TFA
FALGPA, a colorimetric substrate for collagenase, exhibits selectivity over trypsin, thermolysin, and elastase.Fórmula:C23H32N4O7·XCF3COOHForma y color:SolidPeso molecular:476.52Cucumechinoside C
CAS:<p>Cucumechinoside C is a bioactive natural chemical.</p>Fórmula:C54H86O28S2Pureza:98%Forma y color:SolidPeso molecular:1247.37Boc-Glu(OBzl)-OH
CAS:Boc-Glu(OBzl)-OH (Boc-Glu(OBzl)-OH) is an Glutamic acid derivative.Fórmula:C17H23NO6Pureza:98.11%Forma y color:SolidPeso molecular:337.37Conopressin S
CAS:Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Fórmula:C41H73N17O10S2Pureza:98%Forma y color:SolidPeso molecular:1028.26transferrin fragment
Transferrin: primary animal serum iron-binder, similar to lactoferrin, ~80k Da, two-lobed glycoprotein, each lobe has one metal site.Fórmula:C75H121N23O28SPureza:98%Forma y color:SolidPeso molecular:1824.97Uty HY Peptide (246-254)
CAS:Uty HY Peptide (246-254) is a male-specific antigen from Y chromosome H-YDB gene.Fórmula:C53H77N15O13S2Pureza:98%Forma y color:SolidPeso molecular:1196.4Difopein TFA (396834-58-5 free base)
Difopein (TFA) is a 14-3-3 protein inhibitor that induces apoptosis and boosts cisplatin efficacy.Fórmula:C275H425N76F3O91S6Pureza:98%Forma y color:SolidPeso molecular:6501.19EGFRvIII peptide PEPvIII acetate
EGFRvIII peptide PEPvIII acetate, a tumor-specific mutation, is prevalent in GBM and other cancers, increasing tumorigenicity.Fórmula:C72H115N19O26SPureza:96.21%Forma y color:SolidPeso molecular:1694.86SPACE peptide acetate
SPACE peptide acetate is a skin penetrating peptide that facilitates the transfer of molecules through the skin.Pureza:98%Forma y color:SolidZiconotide TFA (107452-89-1 free base)
<p>Ziconotide TEA blocks N-type calcium channels on pain pathway neurons, dampening synapse activity and providing strong pain relief.</p>Fórmula:C116H179F21N36O46S7Pureza:98%Forma y color:SolidPeso molecular:3437.3Bombinakinin-GAP
CAS:Bioactive bradykinin-related peptideFórmula:C145H219N39O39S3Pureza:98%Forma y color:SolidPeso molecular:3228.72Tetrapeptide-5
CAS:Tetrapeptide-5 is a humectant or hydroscopic moisturizer.Fórmula:C18H26N8O6Pureza:98%Forma y color:SolidPeso molecular:450.45Biotin-TAT (47-57) acetate
Biotin-TAT (47-57) acetate: a biotin-labeled TAT peptide, used in protein transduction.Fórmula:C76H136N34O18SPureza:99.31%Forma y color:SolidPeso molecular:1846.18Spaglumic acid acetate
Spaglumic acid acetate (Isospaglumic acid acetate) is a neuropeptide found in millimolar concentrations in brain.Fórmula:C13H20N2O10Pureza:99.49%Forma y color:SolidPeso molecular:364.31Maurocalcine TFA
Maurocalcine TFA acts as an agonist for ryanodine receptor (RyR) channels 1, 2, and 3, demonstrating cell-penetrating capabilities. It induces binding of [3H]ryanodine to RyR1 with an EC50 of 2558 nM and exhibits an apparent affinity of 14 nM for RyR2. This compound is applicable for in vivo cell tracking or other cellular imaging techniques.Fórmula:C156H270N56O46S6·xC2HF3O2Forma y color:SolidPeso molecular:3858.55 (free base)pYEEI
<p>pYEEI, a tetrapeptide containing phosphotyrosine, binds to the SrcSH2 domain with a dissociation constant (Kd) of 100 nM and an inhibitory concentration (IC50) of 6.5 μM. This compound plays a crucial role in cancer research.</p>Fórmula:C25H36N3O14PForma y color:SolidPeso molecular:633.54Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Fórmula:C44H71N11O12S2Pureza:98%Forma y color:SolidPeso molecular:1010.23Enhanced Green Fluorescent Protein (EGFP) (200-208)
CAS:Enhanced Green Fluorescent Protein (200-208) (EGFP (200-208)) is a peptide that strongly binds to H2-K, a restricted cytotoxic T lymphocyte (CTL) epitope.Fórmula:C45H70N12O15Pureza:98.54% - 99.85%Forma y color:SolidPeso molecular:1019.11LRRKtide TFA
LRRKtide, a peptide substrate for leucine-rich repeat kinase 2 (LRRK2)—an enzyme often mutated in Parkinson's disease patients—corresponds to amino acids 550-Fórmula:C83H147N31O22·XCF3COOHForma y color:SolidPeso molecular:1931.30RLLFT-NH2
CAS:TFLLR-NH2, reversed amino acid sequence control peptide, is a PAR1 selective agonist that significantly increases the nociceptive threshold.Fórmula:C31H53N9O6Pureza:98%Forma y color:SolidPeso molecular:647.81Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.Fórmula:C85H127N25O27SPureza:98%Forma y color:SolidPeso molecular:1963.13Relaxin C-peptide
CAS:Relaxin C-peptide, as a synthetic 14-amino acid peptide found in human decidua & placenta, can represent a partial sequence of human relaxin connecting peptide.Fórmula:C75H118N20O24Pureza:98%Forma y color:SolidPeso molecular:1683.885AF2 Neuropeptide
CAS:AF2 is the nematode neuropeptide. It also increases voltage-activated calcium currents in Ascaris suum muscle.Fórmula:C47H70N14O10Pureza:98%Forma y color:SolidPeso molecular:991.15vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.Fórmula:C54H95N17O17Pureza:98%Forma y color:SolidPeso molecular:1254.44Solnatide
CAS:Solnatide is a synthetic peptide mimicking the lectin-like domain of TNF.Fórmula:C82H119N23O27S2Pureza:98%Forma y color:SolidPeso molecular:1923.09Men 10456
CAS:<p>Men 10456 is a MEN 10376 derivative.</p>Fórmula:C57H67N11O11Pureza:98%Forma y color:SolidPeso molecular:1082.21HiBiT tag
CAS:The HiBiT tag, a complementary peptide (VSGWRLFKKIS), exhibits high affinity for LgBiT. It is fused with the Gβ subunit of the receptor. The interaction between LgBiT and HiBiT facilitates the stabilization of ETR and G proteins. Additionally, HiBiT can be attached to target proteins (GFP) to quantify their transport to the cytosol.Fórmula:C63H101N17O14Forma y color:SolidPeso molecular:1320.58ferritin heavy chain fragment [Multiple species]
Ferritin is a ubiquitous 450 kDa protein with 24 subunits, inverts have L and H types (19/21 kDa), cancer cells mainly show H chains with ferroxidase activity.Fórmula:C49H80N12O15Pureza:98%Forma y color:SolidPeso molecular:1077.23Apraglutide TFA (1295353-98-8 free base)
Apraglutide TFA is a synthetic 33-amino acid, long-acting GLP-2 analog that promotes intestine growth in short bowel syndrome.Fórmula:C172H263N43O52·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:3879.27Xenopsin TFA (51827-01-1 free base)
Xenopsin TFA, a neurotensin-like octapeptide from Xenopus skin, inhibits gastric acid secretion.Fórmula:C49H74F3N13O12Pureza:98%Forma y color:SolidPeso molecular:1094.19AUNP-12 TFA (1353563-85-5 free base)
AUNP-12 TFA is a polypeptide that blocks PD-1, PD-L1, and PD-L2, safeguarding lymphocyte growth and function.Fórmula:C144H227F3N40O50Pureza:98%Forma y color:SolidPeso molecular:3375.63Angiotensin I, asn(1)-val(5)-gly(9)-
CAS:Angiotensin I, asn(1)-val(5)-gly(9)- is isolated from the plasma of American eel, Anquilla rostrata.Fórmula:C57H84N16O13Pureza:98%Forma y color:SolidPeso molecular:1201.38HBcAg [Hepatitis B virus] (18-27)
HBcAg indicates active Hep B replication—suggests high transmission risk.Fórmula:C58H78N10O15Pureza:98%Forma y color:SolidPeso molecular:1155.3Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Forma y color:SolidPeso molecular:3692.15Locustamyotropin
CAS:Locustamyotropin is a novel peptide isolated from Leucophae maderae; stimulates the spontaneous contractions of the hindgut of Leucophaea maderae.Fórmula:C55H89N17O14Pureza:98%Forma y color:SolidPeso molecular:1212.4OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Forma y color:SolidPeso molecular:1489.59BDC2.5 mimotope 1040-31 TFA(329696-49-3 free base)
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5.Fórmula:C65H98F3N17O16SPureza:98%Forma y color:SolidPeso molecular:1462.63JAG-1, scrambled
CAS:This peptide is a scrambled sequence of JAG-1(188-204).Fórmula:C93H127N25O26S3Pureza:98%Forma y color:SolidPeso molecular:2107.35IRBP(668-687) (TFA) (1977546-93-2 free base)
<p>IRBP(668-687) TFA, a segment of human IRBP, can cause uveitis.</p>Fórmula:C93H152F3N25O34Pureza:98%Forma y color:SolidPeso molecular:2221.34β-Casomorphin, human TFA (102029-74-3 free base)
<p>β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) an opioid peptide that ACTS as an opioid receptor agonist.</p>Fórmula:C46H62F3N7O13Pureza:98%Forma y color:SolidPeso molecular:978.02Semax
CAS:Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH) that has neuroprotective, analgesic, and anxiolytic properties.Fórmula:C37H51N9O10SPureza:98%Forma y color:SolidPeso molecular:813.93Pseudo RACK1
Protein kinase C activator linked to Antennapedia domain for cell entry; ensures quick uptake and intracellular release.Fórmula:C144H225N43O34S3Pureza:98%Forma y color:SolidPeso molecular:3198.81Dynamin inhibitory peptide, myristoylated (control)
Myristoylated control peptide inhibits dynamin GTPase, blocking its amphiphysin binding and preventing endocytosis, without affecting GABAA receptor IPSPs.Fórmula:C61H107N19O14Pureza:98%Forma y color:SolidPeso molecular:1330.64Sphistin Synthetic Peptide
Sphistin peptide (12-38, FITC-labeled N-terminus) is a potent antimicrobial truncated fragment.Fórmula:C159H250N50O37SPureza:98%Forma y color:SolidPeso molecular:3486.06Acyl Carrier Protein (ACP) (65-74)
CAS:ACP (65-74) is a plastidial fatty acid synthetase fragment binding acyl groups with 4-phosphopantetheine.Fórmula:C47H74N12O16Pureza:98%Forma y color:SolidPeso molecular:1063.16HATU
CAS:Fórmula:C10H15F6N6OPPureza:≥ 99.0%Forma y color:White crystalline powderPeso molecular:380.23Peptide T amide
CAS:Peptide T amide is an octapeptide segment of HIV envelope gp120 and is used in AIDS therapy.Fórmula:C35H56N10O15Pureza:98%Forma y color:SolidPeso molecular:856.888CRF, bovine TFA (92307-52-3 free base)
CRF, bovine (TFA), agonizes CRF receptor, displacing [125I-Tyr]ovine CRF, Ki 3.52 nM, pEC50s: hCRF1 11.16, hCRF2 8.53, rCRF2α 8.70.Fórmula:C208H341F3N60O65SPureza:98%Forma y color:SolidPeso molecular:4811.36Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.Fórmula:C32H45N9O10SPureza:98%Forma y color:SolidPeso molecular:747.82Pentapeptide-4
CAS:Pentapeptide-4 is a matrikine utilized in anti-wrinkle cosmetics.Fórmula:C23H45N7O9Pureza:98%Forma y color:SolidPeso molecular:563.64immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Fórmula:C54H83N13O13Pureza:98%Forma y color:SolidPeso molecular:1122.32F-Chemotactic peptide-fluorescein
CAS:F-Chemotactic peptide-fluorescein is a fluorescent label.Fórmula:C64H76N8O14SPureza:98%Forma y color:SolidPeso molecular:1213.41GTP-Binding Protein Fragment, G α
Three GTP-binding protein alpha subunits stay membrane-bound post-activation and are cleaved by trypsin, releasing fragments; previously thought cytoplasmic.Fórmula:C66H118N20O23S2Pureza:98%Forma y color:SolidPeso molecular:1623.89Extracellular Death Factor TFA
Extracellular death factor TFA (EDF TFA) is a linear pentapeptide that communicating cells produce and release, which activates the cell death pathway.Pureza:98.77%Forma y color:Odour SolidCALP3 TFA(261969-05-5 free base)
CALP3 TFA is a potent Ca2+ channel blocker that activates EF-hand motifs of Ca2+-binding proteins.Fórmula:C46H69F3N10O11Pureza:98%Forma y color:SolidPeso molecular:995.1C-Peptide 2, rat acetate
C-Peptide 2, rat acetate is a proinsulin component of inhibiting glucose-induced insulin secretion, consisting of acetate and a polypeptide composed of 31 aminoFórmula:C137H226N38O51Pureza:98%Forma y color:SolidPeso molecular:3221.48GnRH-I
GnRH-I, a 10-amino-acid peptide from the hypothalamus, regulates vertebrate reproduction and pulsates in the bloodstream.Fórmula:C50H75N17O13Pureza:98%Forma y color:SolidPeso molecular:1182.32Ziptide TFA
Ziptide, a peptide substrate, is recognized by several serine/threonine protein kinases, such as MAPK activated protein kinase 2 (MAPKAPK2), MAPKAPK3, MAPKAPK5Fórmula:C65H109N19O19·XCF3COOHForma y color:SolidPeso molecular:1460.70Margatoxin TFA
Margatoxin TFA, an alpha-KTx scorpion toxin isolated from Centruroides margaritatus venom, is a 39-amino-acid peptide that serves as a high-affinity inhibitorFórmula:C178H286N52O50S7·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:4178.95 (free base)PKC ζ pseudosubstrate
Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.Fórmula:C208H336N74O44S3Pureza:98%Forma y color:SolidPeso molecular:4673.59Amyloid Precursor C-Terminal Peptide
Amyloid precursor peptide involved in Alzheimer's forms plaques; sequence Gly-Tyr-Glu-Asn-Pro-Thr-Y-Lys-Phe-F-Glu-Gln-M-Gln-Asn. Linked to astrocytosis.Fórmula:C86H118N20O27S1Pureza:98%Forma y color:SolidPeso molecular:1896.04κM-Conotoxin RIIIK
CAS:κM-Conotoxin RIIIK is a potassium channel antagonist that inhibits voltage-activated potassium ion channels [1].Fórmula:C106H178N34O33S6Pureza:98%Forma y color:SolidPeso molecular:2649.15C-Type Natriuretic Peptide (1-22) acetate(human)
CNP (1-22), human acetate, NPR-B agonist, inhibits cAMP synthesis, counters histamine and 5-HT effects.Fórmula:C97H162F3N27O32S3Pureza:95.95%Forma y color:SolidPeso molecular:2371.68GrTx1
GrTx1, a peptide toxin derived from Grammostola rosea spider venom, selectively inhibits sodium channels Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, and Nav1.7,Fórmula:C159H243N45O41S8Pureza:98%Forma y color:SolidPeso molecular:3697.43Ac-AAVALLPAVLLALLAP-DEVD-CHO
CAS:Ac-AAVALLPAVLLALLAP-DEVD-CHO (DEVD-CHO-CPP 32) serves as a potent and reversible inhibitor of caspase-3 [1].Fórmula:C94H158N20O27Pureza:98%Forma y color:SolidPeso molecular:2000.38Stromatoxin 1
CAS:Stromatoxin 1, a peptide isolated from tarantulas, acts as an inhibitor of various potassium channels, including K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3.Fórmula:C156H237N49O48S7Pureza:98%Forma y color:SolidPeso molecular:3791.31ε-V1-2, Cys-conjugated
Epsilon-V1-2, a Cys-conjugated, is a biologically active peptide known as the εPKC-specific inhibitor.Fórmula:C40H70N10O14SPureza:98%Forma y color:SolidPeso molecular:947.11Cyclo(Ala-Arg-Gly-Asp-Mamb)
CAS:<p>Cyclo(Ala-Arg-Gly-Asp-Mamb) is a selective antagonist of the RGD peptide with potential applications in pulmonary arterial hypertension research [1].</p>Fórmula:C23H32N8O7Pureza:98%Forma y color:SolidPeso molecular:532.55Cardiotoxin Analog (CTX) IV (6-12)
CAS:Cardiotoxin Analog (CTX) IV (6-12) is a part peptide of Cardiotoxin Analog (CTX) IV. Cardiotoxin analogues IV isolated from the venom of Taiwan Cobra.Fórmula:C48H70N10O7Pureza:98%Forma y color:SolidPeso molecular:899.13Cytochrome c fragment (93-108)
Cytochrome c: small heme protein in mitochondria, has methylated lysines in some eukaryotes, essential for Apaf-1.Fórmula:C79H133N23O25Pureza:98%Forma y color:SolidPeso molecular:1805.04µ-Conotoxin GIIIB
CAS:μ-Conotoxin GIIIB, a 22-residue polypeptide derived from the venom of the piscivorous cone snail Conus geographus, serves as an inhibitor of the Na V 1.4Fórmula:C101H175N39O30S7Pureza:98%Forma y color:SolidPeso molecular:2640.17Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Fórmula:C26H51N3O5Pureza:98%Forma y color:SolidPeso molecular:485.7type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Fórmula:C47H77N13O15Pureza:98%Forma y color:SolidPeso molecular:1064.19ω-Conotoxin CVIB
CAS:ω-Conotoxin CVIB is an antagonist of non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs).Fórmula:C102H173N41O32S7Pureza:98%Forma y color:SolidPeso molecular:2710.18Myoregulin
Myoregulin (MLN peptide), a regulin family member, modulates muscle performance through intracellular calcium handling.Fórmula:C239H391N53O67S3Pureza:98%Forma y color:SolidPeso molecular:5175.17FLDKFNHEAEDLFYQSSL
FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to the SARS-CoV-2 receptor-binding domain (RBD). It inhibits the entry of SARS-CoV-2 and also interacts with binding residues (Leu455, Phe456, Ala475, and Gln493).Fórmula:C102H143N23O32Forma y color:SolidPeso molecular:2203.36WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Fórmula:C55H74N10O13SPureza:98%Forma y color:SolidPeso molecular:1115.3
![[Pro3]-GIP (Mouse) acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2020L.webp&w=3840&q=75)
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![ferritin heavy chain fragment [Multiple species]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2248.webp&w=3840&q=75)
![HBcAg [Hepatitis B virus] (18-27)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2231.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
