Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30316 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
TCS 184
CAS:Scrambled control peptide for use with TCS 183Fórmula:C58H96N20O20SPureza:98%Forma y color:SolidPeso molecular:1425.57MHC class II antigen (45-57) [Homo sapiens]
MHC class II (45-57) peptide, sequence DLDKKETVWHLEE, MW 1868.07, in human antigen-presenting cells/lymphocytes.Fórmula:C73H112N18O25Pureza:98%Forma y color:SolidPeso molecular:1641.78HIV-1 Rev (34-50)
CAS:HIV-1 Rev (34-50) (HIV-1 rev Protein (34-50)) is a 17 amino acid peptide with anti-HIV-1 activity.Fórmula:C97H173N51O24Pureza:99.91%Forma y color:SolidPeso molecular:2437.74Anthopleurin-C
<p>Anthopleurin-C (APE 2-1) is a cardiotonic polypeptide exhibiting a potent positive inotropic effect [1].</p>Fórmula:C210H316N62O61S6Pureza:98%Forma y color:SolidPeso molecular:4877.52CysHHC10 TFA(1408311-03-4 free base)
CysHHC10 TFA is a synthetic antimicrobial peptide (AMP), and exhibits strong anti-microbial properties against both Gram-positive and Gram-negative bacteria.Fórmula:C79H108F3N23O12SPureza:98%Forma y color:SolidPeso molecular:1660.91Quinupristin (mesylate) (120138-50-3 free base)
Quinupristin: a streptogramin antibiotic combatting multidrug-resistant S. aureus and Enterococcus.Fórmula:C53H68N9O10S·CH3SO3Pureza:98%Forma y color:SolidPeso molecular:1118.3Gly-Phe β-naphthylamide acetate
Gly-Phe β-naphthylamide acetate is the substrate of Cathepsin C and can be used for research on the function of cathepsin C, intralysosomal hydrolysis andFórmula:C23H25N3O4Pureza:99.56%Forma y color:SolidPeso molecular:407.46survivin (baculoviral IAP repeat-containing protein 5) (21-28)
Survivin, often up-regulated in tumors, inhibits apoptosis and regulates mitosis, linking high levels to poor cancer prognosis.Fórmula:C54H73N11O11Pureza:98%Forma y color:SolidPeso molecular:1052.22Sakamototide substrate peptide TFA
Sakamototide substrate peptide TFA is a peptide substrate of AMPK kinase family and can be used for the determination of kinase activity.Fórmula:C71H123F3N30O25Pureza:98%Forma y color:SolidPeso molecular:1853.92TP508 TFA (121341-81-9 free base)
TP508 TFA, a thrombin peptide, activates eNOS in endothelial cells, boosting NO production and tissue regeneration.Fórmula:C99H147N28F3O38SPureza:98%Forma y color:SolidPeso molecular:2426.46SPR741 TFA (1179330-52-9 free base)
<p>SPR741 TFA (NAB741 TFA) is a cationic peptide derived from polymyxin B and is a potentiator molecule.</p>Fórmula:C46H74F3N13O15Pureza:98%Forma y color:SolidPeso molecular:1106.15Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]
IGHM fragment [Homo sapiens]: Part of B-cell antigen recognition; 2 heavy, 2 light chains; contains antigen-binding site.Fórmula:C82H132N24O20Pureza:98%Forma y color:SolidPeso molecular:1774.07Fmoc-Cys(Acm)-OH
CAS:<p>Fmoc-Cys(Acm)-OH (Fmoc-S-acetamidomethyl-L-cysteine) is a cysteine derivative.</p>Fórmula:C21H22N2O5SPureza:99.89%Forma y color:SolidPeso molecular:414.47Ac-Leu-Arg-AMC
CAS:Ac-Leu-Arg-AMC is a fluorogenic peptide substrate.Fórmula:C24H34N6O5Pureza:98%Forma y color:SolidPeso molecular:486.56[Des-octanoyl]-Ghrelin (rat)
CAS:[Des-octanoyl]-Ghrelin (rat) is a Non-acylated, major circulating isoform of ghrelin.Fórmula:C139H231N45O41Pureza:98%Forma y color:SolidPeso molecular:3188.6Phytochelatin 3
CAS:Phytochelatin 3 (PC3) is a glutathione-derived peptide and heavy metal detoxifier/chelator consisting of 3 units of glu-cys.Fórmula:C26H41N7O14S3Forma y color:SolidPeso molecular:771.84Fmoc N-hydroxysuccinimide ester
CAS:Fórmula:C19H15NO5Pureza:≥ 98.0%Forma y color:White to off-white crystalline powderPeso molecular:337.34Cyclo(RGDfC) TFA
Zelminemab (AMG-301) is a humanized monoclonal antibody targeting ADCYAP1R1 for use in neurological disorders.Fórmula:C26H35F3N8O9SPureza:98.59%Forma y color:SolidPeso molecular:692.67HIV-1 TAT (48-60) Acetate
Lilotomab (HH1) is a murine anti-CD37 antibody that can be used to synthesize anti-CD37 antibody-radionuclide couplings.Fórmula:C72H135N35O18Pureza:99.93%Forma y color:SoildPeso molecular:1779.07Rac1 Inhibitor F56, control peptide
CAS:Control peptide version of Rac1 Inhibitor; comprises residues 45-60 of Rac1 with Trp56 replaced by Phe. Does not affect GEF-Rac1 interaction.Fórmula:C72H116N18O23SPureza:98%Forma y color:SolidPeso molecular:1632.89Lamin fragment
Lamin: α-helical, intermediate filament protein; key in nuclear lamina structure & nuclear functions; sequence: Lys-Ala-Gly-Gln-Val-Val-Thr-Ile-Trp.Fórmula:C47H76N12O12Pureza:98%Forma y color:SolidPeso molecular:1001.18Dusquetide aceate
<p>Dusquetide acetate: innate immune modulator with anti-inflammatory and antibacterial properties.</p>Fórmula:C27H51N9O7Pureza:97.33%Forma y color:SolidPeso molecular:613.75Locustapyrokinin II
CAS:Locustapyrokinin II is a member of the FXPRL-amide peptide family isolated from Locusta migratoria.Fórmula:C65H98N16O17Pureza:98%Forma y color:SolidPeso molecular:1375.594Saniculoside R 1
CAS:Saniculoside R 1 is a new triterpenoid saponin from Sanicula europaea.Fórmula:C52H84O22Pureza:98%Forma y color:SolidPeso molecular:1061.222Cortistatin-14 TFA (186901-48-4 free base)
Cortistatin-14 is a neuropeptide have structural similarity to somatostatin-14. It is produced in the cortex and hippocampus of central nervous system.Fórmula:C83H115F3N20O20S2Pureza:98%Forma y color:SolidPeso molecular:1834.05p2Ca
CAS:p2Ca, peptide from alpha-ketoglutarate dehydrogenase, pairs with MHC-I protein Ld, recognized by CTL clone 2C.Fórmula:C47H66N8O12Pureza:98%Forma y color:SolidPeso molecular:935.07BCMA72-80
CAS:<p>BCMA72-80: HLA-A2-specific peptide with high affinity; used in multiple myeloma and other BCMA+ tumor research.</p>Fórmula:C59H97N13O11SPureza:98%Forma y color:SolidPeso molecular:1196.55TNF-α (31-45), human TFA (144796-71-4 free base)
<p>TNF-α (31-45), human (TFA) is a peptide of tumor necrosis factor-α.</p>Fórmula:C71H123F3N26O24Pureza:98%Forma y color:SolidPeso molecular:1781.89Ceratotoxin A acetate
Ceratotoxin A acetate is isolated from the accessory gland secretion fluid, with anti-bacterial effects.Fórmula:C137H247N35O34Pureza:98.49%Forma y color:SolidPeso molecular:2928.64Flagelin 22 acetate
Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.Fórmula:C95H166N32O36Pureza:95.93%Forma y color:SolidPeso molecular:2332.56Pam2CSK4 Biotin
biotinylated Pam2CSK4, a toll-like receptor 2/6 agonistFórmula:C87H162N14O16S2Pureza:98%Forma y color:SolidPeso molecular:1724.44C112 Peptide
CAS:C112 Peptide is a novel peptide.Fórmula:C27H49N9O7Pureza:98%Forma y color:SolidPeso molecular:611.73Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Fórmula:C20H28F3N3O8Pureza:98%Forma y color:SolidPeso molecular:495.45ACTH (22-39) acetate
ACTH (22-39) acetate is a fragment of adrenocorticotropic hormone (ACTH) containing two proline residues at positions 3 and 15 from the N-terminus.Fórmula:C92H129N19O34Pureza:98.14%Forma y color:SolidPeso molecular:2045.12Maraciclatide
CAS:Maraciclatide is a radiopharmaceutical targeting αvβ3 integrin.Fórmula:C72H120N20O21S3Pureza:98%Forma y color:SolidPeso molecular:1698.05GO-203 acetate
GO-203 acetate is an effective inhibitor of potent MUC1-C oncoprotein. GO-203 acetate exhibits anti-cancer activities targeting intracellular proteins.Fórmula:C91H175F3N52O23S2Pureza:98.86%Forma y color:SolidPeso molecular:2486.82Pep1-TGL
Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunitFórmula:C41H71N11O15SPureza:98%Forma y color:SolidPeso molecular:990.14Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]
Cytochrome c: small heme protein, in mitochondria, has methylated lysines in some eukaryotes, crucial for Apaf-1 function.Fórmula:C50H80N12O13Pureza:98%Forma y color:SolidPeso molecular:1057.24Sperm-activating peptide 1
CAS:Sperm-activating peptide 1 is a bioactive chemical.Fórmula:C44H71N11O12S2Pureza:98%Forma y color:SolidPeso molecular:1010.23NEP(1-40)
CAS:<p>Nogo-66 (1–40) peptide blocks NgR, enhances axonal growth, and aids spinal recovery, but doesn't affect MAG inhibition.</p>Fórmula:C206H324N56O65Pureza:98%Forma y color:SolidPeso molecular:4625.16FS-2
FS-2 is a potent, specific inhibitor of L-type CaV channels, effectively impeding high K+ or glucose-induced L-type Ca2+ influx in RIN beta cells [1].Fórmula:C297H462N92O86S10Pureza:98%Forma y color:SolidPeso molecular:7018.06Collagen type IV α1 (531-543)
CAS:Human COL4A1 gene on chromosome 13 encodes protein collagen IV α1 (531-543), a ubiquitous subunit important for angiogenesis.Fórmula:C74H110N18O21Pureza:98%Forma y color:SolidPeso molecular:1587.77β-amyloid (12-28) (TFA) (107015-83-8 free base)
β-amyloid (12-28) TFA, a peptide fragment of β-amyloid protein (β1-42), is the major component of senile plaque cores.Fórmula:C91H136N25F3O27Pureza:98%Forma y color:SolidPeso molecular:2069.2GLGPNPCRKKCYKRDFLGR
GLGPNPCRKKCYKRDFLGR is a synthetic peptide.Fórmula:C96H158N32O24S2Pureza:98%Forma y color:SolidPeso molecular:2208.64Leu-Val
CAS:Leu-Val (L-leucyl-L-valine) is a novel potent dipeptide with antibacterial and antimalarial activity.Fórmula:C11H22N2O3Pureza:99.32%Forma y color:SolidPeso molecular:230.3Ac-AAVALLPAVLLALLAP-YVAD-CHO
CAS:Ac-AAVALLPAVLLALLAP-YVAD-CHO is a cell-permeable inhibitor of caspase-1 exhibiting antitumor activity [1].Fórmula:C97H160N20O24Pureza:98%Forma y color:SolidPeso molecular:1990.43PR 39 (porcine) acetate
PR 39 (porcine) acetate is a noncompetitive, reversible and allosteric proteasome inhibitor.Pureza:98%Forma y color:LiquidPeso molecular:N/AAbecomotide
CAS:Abecomotide is a bioactive chemical.Fórmula:C45H79N13O16Pureza:98%Forma y color:SolidPeso molecular:1058.19RLLFT-NH2
CAS:TFLLR-NH2, reversed amino acid sequence control peptide, is a PAR1 selective agonist that significantly increases the nociceptive threshold.Fórmula:C31H53N9O6Pureza:98%Forma y color:SolidPeso molecular:647.81wt hMLN
Wild-type human myoregulin (wt hMLN) is a microprotein that inhibits the sarcoplasmic reticulum Ca²⁺ pump (SERCA), playing a crucial role in the regulation ofFórmula:C245H404N54O66SPureza:98%Forma y color:SolidPeso molecular:5194.22Conotoxin GII
CAS:Conotoxin GII is a highly toxic peptide.Fórmula:C57H81N19O16S4Pureza:98%Forma y color:SolidPeso molecular:1416.63vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.Fórmula:C54H95N17O17Pureza:98%Forma y color:SolidPeso molecular:1254.44Trempamotide
CAS:Trempamotide is a bioactive chemical.Fórmula:C58H80N10O18Pureza:98%Forma y color:SolidPeso molecular:1205.31CLIP (86-100) (TFA) (648881-58-7 free base)
CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.Fórmula:C74H129F3N20O21S3Pureza:98%Forma y color:SolidPeso molecular:1788.13OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Forma y color:SolidPeso molecular:1489.59Maurocalcine
CAS:Maurocalcine is a cell-permeable agonist for ryanodine receptor (RyR) subtypes 1, 2, and 3.Fórmula:C156H270N56O46S6Pureza:98%Forma y color:SolidPeso molecular:3858.55ω-Conotoxin MVIID
<p>ω-Conotoxin MVIID (SNX-238) is a peptide from the Conus genus that inhibits the ω-Conotoxin-GVIA-sensitive, high-threshold calcium (Ca 2+) current in fish</p>Fórmula:C99H164N42O33S7Pureza:98%Forma y color:SolidPeso molecular:2695.08Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Forma y color:SolidPeso molecular:3692.15type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Fórmula:C47H77N13O15Pureza:98%Forma y color:SolidPeso molecular:1064.19β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Fórmula:C49H76N12O15Pureza:98%Forma y color:SolidPeso molecular:1073.2TAK-683 TFA (872719-49-8 free base)
TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.Fórmula:C66H84F3N17O15Pureza:98%Forma y color:SolidPeso molecular:1412.47Biotin-Crosstide TFA
Biotin-crosstide is a derivative of the peptide Akt substrate crosstide, featuring biotinylation.Fórmula:C58H91N19O19S·XCF3COOHForma y color:SolidPeso molecular:1390.53Cyclo(Phe-Pro) acetate(14705-60-3 free base)
Cyclo(Phe-Pro) acetate(14705-60-3 free base), known as a secondary metabolite of some bacteria and fungi, is also produced by Vibrio vulnificus.Fórmula:C16H20N2O4Pureza:98%Forma y color:SolidPeso molecular:304.35Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Fórmula:C59H92F3N19O14Pureza:98%Forma y color:SolidPeso molecular:1348.48Preprosomatostatin (25-34)
CAS:Preprosomatostatin (25-34) is a peptide.Fórmula:C52H83N17O15Pureza:98%Forma y color:SolidPeso molecular:1186.32CGRP(83-119), rat
<p>Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor.</p>Fórmula:C162H262N50O52S2Pureza:98%Forma y color:SolidPeso molecular:3806.3Agavoside E
CAS:<p>Agavoside E is a biochemical.</p>Fórmula:C62H100O31Pureza:98%Forma y color:SolidPeso molecular:1341.451Neuropeptide Y (scrambled) Acetate
<p>Neuropeptide Y (scrambled) Acetate (Pro-Neuropeptide Y (scrambled) Acetate) is a scrambled peptide of Neuropeptide Y that has been implicated in Alzheimer's</p>Fórmula:C190H287N55O57Pureza:99.07% - 99.57%Forma y color:SolidPeso molecular:4251.12Lliumoside C
CAS:Lliumoside C is a bioactive chemical.Fórmula:C63H104O31Pureza:98%Forma y color:SolidPeso molecular:1357.494cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Fórmula:C126H202N42O40S2Pureza:98%Forma y color:SolidPeso molecular:3009.36LLO (91-99) acetate
<p>LLO (91-99) acetate: an exotoxin, class I MHC T-cell epitope, crucial for T-cell immunity induction.</p>Fórmula:C49H71N11O19Pureza:98%Forma y color:SolidPeso molecular:1118.15Fz7-21 TFA (2247635-23-8 free base)
Fz7-21 TFA is a peptide that blocks FZD7 receptors, with EC50 of 58 nM (human) and 34 nM (mouse).Fórmula:C85H115N18F3O25S2Pureza:98%Forma y color:SolidPeso molecular:1910.07µ-Conotoxin BuIIIB
CAS:<p>μ-Conotoxin BuIIIB (Mu-Conotoxin BuIIIB), a selective blocker of mammalian neuronal voltage-gated sodium channels (VGSC), is derived from Cone snail venom and</p>Fórmula:C106H172N46O30S6Pureza:98%Forma y color:SolidPeso molecular:2763.18Transportan
CAS:Transportan: 27 amino acids with galanin's N-terminus and mastoparan's C-terminus, linked by lysine.Fórmula:C134H227N35O32Pureza:98%Forma y color:SolidPeso molecular:2840.45Magaratensin
CAS:Magaratensin is a neurotensin-related peptide related to the skin of Rana margarate.Fórmula:C53H83N15O15Pureza:98%Forma y color:SolidPeso molecular:1170.32Hemoregulatory peptide 5b
CAS:Hemoregulatory peptide 5b, a synthetic granulocyte chalone analog, inhibits GM-CFC colony formation and murine CRU-S cell activation.Fórmula:C23H36N6O11SPureza:98%Forma y color:SolidPeso molecular:604.63α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]
Protease inhibitorFórmula:C51H85N11O12SPureza:98%Forma y color:SolidPeso molecular:1076.35Enhanced Green Fluorescent Protein (EGFP) (200-208)
CAS:Enhanced Green Fluorescent Protein (200-208) (EGFP (200-208)) is a peptide that strongly binds to H2-K, a restricted cytotoxic T lymphocyte (CTL) epitope.Fórmula:C45H70N12O15Pureza:98.54% - 99.85%Forma y color:SolidPeso molecular:1019.11Lipoxygenase
CAS:Lipoxygenase (LOX) is a dioxygenase that catalyzes the peroxidation of linoleic acid (LA) or arachidonic acid (AA) in the presence of molecular oxygen.Forma y color:SolidPeptide C105Y
CAS:C105Y, a synthetic peptide mimicking alpha1-antitrypsin residues 359-374, boosts DNA nanoparticle gene expression.Fórmula:C97H148N20O23SPureza:98%Forma y color:SolidPeso molecular:1994.4RR-src acetate
CAS:RR-src acetate is a synthetic peptide derived from the amino acid sequence surrounding the phosphorylation site in pp60src.Fórmula:C66H110N22O23Pureza:97.13%Forma y color:SolidPeso molecular:1579.71α-Gliadin (43-49)
CAS:alpha-Gliadin (43-49) is a Gliadian sequence peptide. It could induce leukocyte migration inhibition but be blocked by naloxone.Fórmula:C43H57N9O11Pureza:98%Forma y color:SolidPeso molecular:875.97Acein
<p>ACE ligand with Kd of 2.79 nM; doesn't affect ACE activity ≤500 nM; boosts dopamine release in striatum via NMDA + D-serine.</p>Fórmula:C43H68N10O13Pureza:98%Forma y color:SolidPeso molecular:932.5TKD (450-463)
CAS:TKD (450-463), a 14-peptide (TKDNNLLGRFELSG), exhibits the ability to stimulate NK cells' cytolytic and proliferative activities at concentrations comparable to the full-length Hsp70 protein.Fórmula:C67H110N20O23Forma y color:SolidPeso molecular:1563.71LCMV gp33-41 (TFA) (151705-84-9 free base)
LCMV gp33-41 (TFA) is an 11-aa peptide, MHC class I H-2Db-bound, presented to CTLs.Fórmula:C50H74N11F3015SPureza:98%Forma y color:SolidPeso molecular:1158.24OVA-A2 Peptide acetate(149755-57-7 free base)
OVA-A2 Peptide acetate (SAINFEKL, OVA (257-264) Variant acetate) is a biologically active, antigenic variant of the ovalbumin-derived peptide spanning amino acids 257 to 264.Forma y color:Odour SolidRO7196472
CAS:RO7196472 is a potent macrocyclic peptide antibiotic that selectively inhibits the activity of Acinetobacter strains. It targets the lipopolysaccharide (LPS) binding site on the inner membrane's LptB2FG complex, inhibiting lipopolysaccharide transport and thereby suppressing the activity of Acinetobacter strains.Fórmula:C41H49ClN10O3SForma y color:SolidPeso molecular:797.41Iso-VQA-ACC acetate
Iso-VQA-ACC acetate serves as a substrate for the constitutive proteasome.Forma y color:Odour SolidACTH (1-13)
CAS:ACTH (1-13), a 13-amino acid peptide, protects rats' stomachs from ethanol damage; it’s a stress-response hormone from the pituitary.Fórmula:C75H106N20O19SPureza:98%Forma y color:SolidPeso molecular:1623.83matrix protein (3-15) [Zaire ebolavirus]
Matrix protein (3-15) links viral envelope to ebolavirus core; part of EBOV, a Filoviridae causing fatal hemorrhagic fevers.Fórmula:C69H110N16O20SPureza:98%Forma y color:SolidPeso molecular:1515.77N-Oleoyl Valine Ammonium salt
N-Oleoyl Valine Ammonium salt is an N-acyl amide compound that is a TRPV3 antagonist and can be used to study inflammation.Fórmula:C23H46N2O3Pureza:99.72%Forma y color:SolidPeso molecular:398.62Phytochelatin 4
CAS:<p>Phytochelatin 4 (PC 4) a heavy metal detoxifier/chelator consisting of 4 units of glu - cys , tolerant to Cd (cadmium), ultimately sequestered in the vesicle.</p>Fórmula:C34H53N9O18S4Pureza:95.98%Forma y color:SolidPeso molecular:1004.09Ac-FEID-CMK TFA
Ac-FEID-CMK TFA is a zebrafish GSDMEb-derived peptide inhibitor that acts by inhibiting the caspy2-mediated atypical inflammatory vesicle pathway.Fórmula:C29H38ClF3N4O11Pureza:95%Forma y color:SolidPeso molecular:711.08Peptide VF13N
CAS:<p>Peptide VF13N is a synthetic rabies virus glycoprotein T helper cell epitope.</p>Fórmula:C57H88N14O23SPureza:98%Forma y color:SolidPeso molecular:1369.45IP3RPEP6
CAS:IP3RPEP6 serves as a competitive inhibitor of IP3R. Its IC50 values for IP3R1, IP3R2, and IP3R3 are 9.0 μM, 3.9 μM, and 4.3 μM, respectively. This compound does not affect ryanodine receptors and Cx43 hemichannels, and it is capable of modulating intracellular calcium signaling.Fórmula:C49H79N15O24Forma y color:SolidPeso molecular:1262.24CP61
CAS:CP61, a cyclic peptide, functions as a dual inhibitor of CtBP1/CtBP2. It binds to CtBP1 with an affinity of 3 μM and inhibits both heterodimerization and homodimerization of CtBP2 with an IC50 value of 19 μM. CP61 shows promise for cancer research.Fórmula:C50H73N13O12SForma y color:SolidPeso molecular:1080.26MARCKS Peptide(151-175), Phosphorylated
<p>Myristoylated Alanine-Rich C Kinase Substrate peptide (151-175) is a high affinity Protein Kinase C substrate.</p>Fórmula:C147H246N41O40P3Pureza:98%Forma y color:SolidPeso molecular:3320.8ferritin heavy chain fragment [Multiple species]
Ferritin is a ubiquitous 450 kDa protein with 24 subunits, inverts have L and H types (19/21 kDa), cancer cells mainly show H chains with ferroxidase activity.Fórmula:C49H80N12O15Pureza:98%Forma y color:SolidPeso molecular:1077.23BDC2.5 mimotope 1040-31 TFA(329696-49-3 free base)
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5.Fórmula:C65H98F3N17O16SPureza:98%Forma y color:SolidPeso molecular:1462.63Men 10456
CAS:<p>Men 10456 is a MEN 10376 derivative.</p>Fórmula:C57H67N11O11Pureza:98%Forma y color:SolidPeso molecular:1082.21
![MHC class II antigen (45-57) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2270.webp&w=3840&q=75)
![Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2260.webp&w=3840&q=75)
![[Des-octanoyl]-Ghrelin (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2242.webp&w=3840&q=75)
![Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2238.webp&w=3840&q=75)
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![α-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2216.webp&w=3840&q=75)
![matrix protein (3-15) [Zaire ebolavirus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2184.webp&w=3840&q=75)
![ferritin heavy chain fragment [Multiple species]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2248.webp&w=3840&q=75)
