
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29633 productos de "Péptidos"
NTB (Naltriben)
Catalogue peptide; min. 95% purity
Fórmula:C50H65N11O11S2Peso molecular:1,060.29 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Fórmula:C107H141N22O37PS2Peso molecular:2,422.53 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Fórmula:C59H89N17O14Peso molecular:1,260.47 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C33H36N2O9Pureza:Min. 95%Peso molecular:604.65 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Fórmula:C124H205N39O39S2Peso molecular:2,930.38 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C14H24N2O6·C12H23NPureza:Min. 95%Peso molecular:497.67 g/molRef: 3D-FA107927
Producto descatalogadoAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C173H273N49O52S2Peso molecular:3,935.55 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Fórmula:C176H251N43O53SPeso molecular:3,849.30 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
Catalogue peptide; min. 95% purity
Fórmula:C66H109N23O23Peso molecular:1,592.74 g/molTyr-Leptin (26-39) (human)
CAS:Please enquire for more information about Tyr-Leptin (26-39) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C80H137N19O25Pureza:Min. 95%Peso molecular:1,765.06 g/molRef: 3D-FT109022
Producto descatalogadoGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/molBiotin-Kinase Domain of Insulin Receptor (2)
Catalogue peptide; min. 95% purity
Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molHistone H3 (116-136), N15-39
Catalogue peptide; min. 95% purity
Fórmula:C112H197N39O30Peso molecular:2,570 g/molTryptophan Motif Peptide
Catalogue peptide; min. 95% purity
Fórmula:C35H41N11O7Peso molecular:727.79 g/mol[Gln22]-25359-Amyloid (6-40)
Catalogue peptide; min. 95% purity
Fórmula:C167H258N46O48SPeso molecular:3,710.26 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Fórmula:C110H178N26O31SPeso molecular:2,392.86 g/molRef: 3D-VAC-00589
Producto descatalogadoN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C20H32N4O4Pureza:Min. 95%Forma y color:PowderPeso molecular:392.49 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Fórmula:C35H56N8O9SPeso molecular:765 g/molRef: 3D-VAC-00317
Producto descatalogadoChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Fórmula:C51H76N16O21SPeso molecular:1,269.31 g/molTachykinin (111-129) Beta-Prepro (Human)
Catalogue peptide; min. 95% purity
Fórmula:C96H156N34O31SPeso molecular:2,314.59 g/molFmoc-Glu(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Glu(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111727
Producto descatalogado[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Fórmula:C40H65N13O7Peso molecular:840.05 g/molRef: 3D-VAC-00688
Producto descatalogadoRef: 3D-VAC-00670
Producto descatalogadoAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Fórmula:C185H268N48O51S2Peso molecular:4,044.63 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Fórmula:C25H37N5O7Peso molecular:519.6 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
