
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29874 productos de "Péptidos"
Ac-PKKKRKVEDPYC-NH2
Peptide Ac-PKKKRKVEDPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QIDVALSQDSTYQG-OH
Peptide Ac-QIDVALSQDSTYQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MISEPR^ISY-OH
Peptide H-MISEPR^ISY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALDLLDK^-OH
Peptide H-ALDLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTITAGSK^-OH
Peptide H-FTITAGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVGAVGVGK^-OH
Peptide H-VVVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YNGIITETIK^-OH
Peptide H-YNGIITETIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Angiotensin (1-5)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C30H48N8O9Peso molecular:664.77 g/molKemptide
CAS:Peptide Kemptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C32H61N13O9Peso molecular:771.92 g/molH-CLAVEEVSL^-OH
Peptide H-CLAVEEVSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYPSDIAVEWESNGQPENNYK-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanocyte Associated Antigen gp100
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H68N12O13Peso molecular:961.09 g/molEBV LMP2 200-208 (HLA-B*40:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TTPPVLDSDGSFFLYSR-OH
Peptide H-TTPPVLDSDGSFFLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GG^^G-OH
Peptide H-GG^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2
Peptide Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Carcinoembryonic antigen-related cell adhesion molecule 5 (691-699)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-TESTLNALLQR^-OH
Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDVHYAPTIR^-OH
Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALQVVR^-OH
Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 51 (AHELVCSMENTRATK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,689.9 g/molH2N-Ser-Cys-Arg-Trp-Arg-Phe-Pro-Ala-Arg-Pro-Gly-Th
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C63H96N22O15S1Peso molecular:1,433.64 g/molMyr-SIYRRGARRWRKL-OH
Peptide Myr-SIYRRGARRWRKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2Azido-GRKKRRQRRRPPQ-OH
Peptide 2Azido-GRKKRRQRRRPPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-RYDLGGAGMVC-NH2
Peptide Ac-RYDLGGAGMVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AATVGSLAGQPLQ^ER-OH
Peptide H-AATVGSLAGQPLQ^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WRQAAFVDSY-NH2
Peptide H-WRQAAFVDSY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanotan I
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C78H111N21O19Peso molecular:1,646.9 g/molH-ALPAPIEKTISK-NH2
Peptide H-ALPAPIEKTISK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NGFYPATR^-OH
Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-ARARARAR-OH
Peptide Biot-ARARARAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EKAHDGGR^YYRA-OH
Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ETIPLQETSLYTQDR^-OH
Peptide H-ETIPLQETSLYTQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-113/aa449 - 463
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,684.8 g/molH-GSGDSSQVTQVSPQR^-OH
Peptide H-GSGDSSQVTQVSPQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GLLKLASPELERL-NH2
Peptide Biot-GLLKLASPELERL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Hemorphin-7
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C49H64N12O11Peso molecular:997.12 g/molLCBiot-PRIGGQRELKKITE-OH
Peptide LCBiot-PRIGGQRELKKITE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LCTPSR-NH2
Peptide Ac-LCTPSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPGTYVVVLK^-OH
Peptide H-LPGTYVVVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-RRRR-OH
Peptide 5Fam-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^^-OH
Peptide H-GTFAQLSELHCDK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATEHLSTLSEK^-OH
Peptide H-ATEHLSTLSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 117 (EEDTDEDSDNEIHNP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,758.6 g/molFMRF-like neuropeptide flp-11-3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C53H78N16O12Peso molecular:1,131.2 g/molH-TVLQNWLK^-OH
Peptide H-TVLQNWLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^^GG-OH
Peptide H-G^^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKPGVYTK^-OH
Peptide H-NKPGVYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNVITVGPR^-OH
Peptide H-LNVITVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GP^SVF^PLAPSSK-OH
Peptide H-GP^SVF^PLAPSSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 112
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,727.1 g/molH-YLTWASR^-OH
Peptide H-YLTWASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLVVVGAGGV^-OH
Peptide H-KLVVVGAGGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Octaneuropeptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H74N12O11Peso molecular:911.1 g/molH-GFGFK^-OH
Peptide H-GFGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QV^DYYGLYY-OH
Peptide H-QV^DYYGLYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDNSSLTGESEPQTR^-OH
Peptide H-VDNSSLTGESEPQTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTDNNL^AV^Y-OH
Peptide H-NTDNNL^AV^Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-THRPPMWSPVWP-NH2
Peptide Ac-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:1,531.8 g/molNucleoprotein (396-404)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C50H71N13O14Peso molecular:1,078.18 g/molHemokinin 1 (mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H100N22O15SPeso molecular:1,413.65 g/molH-YSPGGTPTAIK^-OH
Peptide H-YSPGGTPTAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FTISADTSK-OH
Peptide H-FTISADTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C42H68N10O16Peso molecular:969.05 g/molH-YYIAASYVK^-OH
Peptide H-YYIAASYVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASMTNMELM-OH
Peptide H-ASMTNMELM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C40H70N10O15S3Peso molecular:1,027.24 g/molH-VAIDVGYR^-OH
Peptide H-VAIDVGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SSFTVQDLKPFTEYVFR^-OH
Peptide H-SSFTVQDLKPFTEYVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EQLTPLI^K-OH
Peptide H-EQLTPLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ile-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C16H31N3O5Peso molecular:345.43 g/molH-DRV^YI-OH
Peptide H-DRV^YI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTILELFR^-OH
Peptide H-VTILELFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVFVDLEPTVIDEIR^-OH
Peptide H-AVFVDLEPTVIDEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIIPQIVK^-OH
Peptide H-FIIPQIVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KKWKMRRNQFWVKVQRG-OH
Peptide LCBiot-KKWKMRRNQFWVKVQRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HTDDEMTGYVATR^-OH
Peptide H-HTDDEMTGYVATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RIFSTDTGPGGC-Clear-Base Resin
Peptide H-RIFSTDTGPGGC-Clear-Base Resin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Influenza HA (204 - 212)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C49H73N11O15Peso molecular:1,056.19 g/molCMVpp65 - 55 (QVIGDQYVKVYLESF)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788 g/molAc-TPYWMAPE-NH2
Peptide Ac-TPYWMAPE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGVVAAAEK^-OH
Peptide H-EGVVAAAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ENPVVHFFKNIVTPR-OH
Peptide H-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAVENLPTFLVELSR^-OH
Peptide H-AAVENLPTFLVELSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STQAAIDQI^NGK-OH
Peptide H-STQAAIDQI^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Aoa-WLRKKACDVLEIPYVIKQ-OH
Peptide Aoa-WLRKKACDVLEIPYVIKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YRGITCSGRQK-NH2
Peptide H-YRGITCSGRQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTDSEEEIR^-OH
Peptide H-DTDSEEEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTSAPDTRPAPGSTAPPAHG-NH2
Peptide H-VTSAPDTRPAPGSTAPPAHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GHFPLAER^-OH
Peptide H-GHFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVAVYADQAK^-OH
Peptide H-AVAVYADQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H79N11O14S2Peso molecular:1,050.31 g/molH-DLATVYVDVLK^-OH
Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
RK9, p17 Gag (20 - 28)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C45H86N18O10Peso molecular:1,039.3 g/mol5Fam-VIFDANAPVAVR-OH
Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
