
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29793 productos de "Péptidos"
Histone-H2A-(107-122)-Ac-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C81H140N20O23Peso molecular:1,762.1 g/molDOTA-GRRRRRRRRRRR-OH
Peptide DOTA-GRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVLATGLR^-OH
Peptide H-LVLATGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,624.8 g/molHXB2 gag NO-26
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788 g/molHXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molH-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neuromedin U-23 (rat)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C124H180N34O31Peso molecular:2,643 g/molH-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
NR-Box 2 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,574.9 g/molAc-CDYEFEKHINLDQ-NH2
Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QL^DAYPSGAW-OH
Peptide H-QL^DAYPSGAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STDYGIFQINSR^-OH
Peptide H-STDYGIFQINSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SRVEI-NH2
Peptide H-SRVEI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IDR-1
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C65H118N18O15Peso molecular:1,391.76 g/molH-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 68 (RNGFTVLCPKNMIIK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,734.2 g/molH-LQEEDTGEYGCV-NH2
Peptide H-LQEEDTGEYGCV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SELTQQLNALFQDK^-OH
Peptide H-SELTQQLNALFQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRRFSTAPFAFIDINDVINF-NH2
Peptide H-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGFYESDVMGR^-OH
Peptide H-VGFYESDVMGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.NoxA1ds
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C50H88N14O15Peso molecular:1,125.33 g/molAc-SADTNKRKRDEGIQESPVC-NH2
Peptide Ac-SADTNKRKRDEGIQESPVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pHLIP WT
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:4,525.87 g/molH-IIVPLNNR^-OH
Peptide H-IIVPLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Leu-Enkephalin acetate
CAS:Leu-Enkephalin is an endogenous opioid peptide that has been shown to produce analgesia, anti-inflammatory effects, and changes in locomotor activity. Leu-enkephalin binds to the kappa opioid receptor, which is found in high concentrations in the caudate putamen and hippocampal formation. The enkephalins are a family of basic proteins with two amino acids linked by a single amide bond. They are peptide hormones that act as neurotransmitters in the central nervous system and peripheral nervous system. Leu-enkephalin is a drug candidate for treatment of infectious diseases such as HIV and malaria. In addition, leu-enkephalin has been shown to have side effect profiles that are less severe than morphine or methadone.Fórmula:C28H37N5O7·C2H4O2Pureza:Min. 95%Forma y color:PowderPeso molecular:554.64 g/molH-SVINASAAIAPK^-OH
Peptide H-SVINASAAIAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^R^-OH
Peptide H-R^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SL^YNTVATL-OH
Peptide H-SL^YNTVATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CR-NH2
Peptide Ac-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TKEGVLYVGSK^-OH
Peptide H-TKEGVLYVGSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LDPD-OH
Peptide LCBiot-LDPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLGSGAFGTVYK^-OH
Peptide H-VLGSGAFGTVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 107 (AMAGASTSAGRKRKS)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,478.7 g/molCONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE
Peptide CONJUGATE B CONTAINING CAMPTOTHECIN-GLY-SUCCINATE is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TYFAVLM-NH2
Peptide Ac-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 93 (FTSQYRIQGKLEYRH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,927.2 g/molFluor-Y-OH
Peptide Fluor-Y-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AMHVAQPAVVLASSR^-OH
Peptide H-AMHVAQPAVVLASSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 Antigen Peptide NCAP (LLNKHIDAYKTFPPTEPK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C99H154N24O27Peso molecular:2,112.55 g/molMartentoxin I
A synthetic scorpion toxin, sourced from the Scorpion, Buthus martensi which has the following disulfide bonds: Cys8-Cys29, Cys14-Cys34, and Cys18-Cys36. This product is available in the trifluoroacetate salt form. One-Letter-Code: FGLIDVKCFA SSECWTACKK VTGSGQGKCQ NNQCRCYFórmula:C162H253N49O52S6Pureza:Min. 95%Peso molecular:3,911.5 g/molAc-CSDTDSTELASIL-OH
Peptide Ac-CSDTDSTELASIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPPSSGEPPK^-OH
Peptide H-TPPSSGEPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.C34, gp41 HIV Fragment
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C184H280N50O64S1Peso molecular:4,248.8 g/molH-RPILTIITLEDSSGNLLGR^-OH
Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVSLGAGAK^-OH
Peptide H-TVSLGAGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGVNGF^G^R-OH
Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^PPGFSPF-OH
Peptide H-R^PPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WDCCPGCCK-NH2
Peptide Ac-WDCCPGCCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYFQNCPRG-NH2
Peptide H-SYFQNCPRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-TNL-NH2
Peptide Ac-TNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PKCPEPCPPPKCPQPCPP-NH2
Peptide H-PKCPEPCPPPKCPQPCPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-TRPPTLSPIPHIP-NH2
Peptide Biot-TRPPTLSPIPHIP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AL^NSEALSV-OH
Peptide H-AL^NSEALSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGPFSDSYR^-OH
Peptide H-GGPFSDSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-AVAGCAGAR-OH
Peptide Ac-AVAGCAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mal-RTRPLWVRME-OH
Peptide Mal-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NDGYLMFQQVPMVEIDGMK^-OH
Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 56
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,566.7 g/molH-DGQLTIK^-OH
Peptide H-DGQLTIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Cys9] - β - Amyloid (1 - 9)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,079.1 g/molAc-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2
Peptide Ac-VALDPIDISIVLNKIKSDLEESKEWIRRSNKILDSI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 17
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,619.8 g/molH-LVTDLTK^-OH
Peptide H-LVTDLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YGLVTYATYPK^-OH
Peptide H-YGLVTYATYPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLLEYLEEK^-OH
Peptide H-LLLEYLEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2
CAS:Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 is a peptide that has shown to be a potent inhibitor of MMP-1. It may also inhibit other proteases such as collagenase, stromelysin and cathepsins. Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me)-NH2 has a fluorogenic property, which makes it useful for high throughput screening of protease inhibitors. This peptide can be used in the development of new drugs for the treatment and prevention of various diseases such as cancer, cardiovascular disease and arthritis.Fórmula:C51H72N14O12SPureza:Min. 95%Peso molecular:1,105.29 g/molH-SLL^MWITQC-OH
Peptide H-SLL^MWITQC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPTANVSVVDLTCR^-OH
Peptide H-VPTANVSVVDLTCR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Des-Asp187,Met186)-Melanocyte Protein PMEL 17 (185-193) (human, bovine, mouse)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H69N9O11SPeso molecular:920.12 g/molH-VVSVLTVLHQDWLNGK-OH
Peptide H-VVSVLTVLHQDWLNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C83H132N22O22Peso molecular:1,808.1 g/molH-SPDFTNENPLETR^-OH
Peptide H-SPDFTNENPLETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SSVFAQ-OH
Peptide Ac-SSVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DI^TP^TLTL^YVGK^-OH
Peptide H-DI^TP^TLTL^YVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVVQTESGGR^-OH
Peptide H-VVVQTESGGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-FPWFPLPSPYGN-OH
Peptide LCBiot-FPWFPLPSPYGN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ENLQFSAAL^R-OH
Peptide H-ENLQFSAAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ICLDLQAPLYK^-OH
Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-DLDLEMLAPYIPMDDDFQL-OH
Peptide LCBiot-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DQGGELLSLR^-OH
Peptide H-DQGGELLSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GNPARARERLKNIERIC-NH2
Peptide Ac-GNPARARERLKNIERIC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PQQPQQSFPQQQRP-NH2
Peptide H-PQQPQQSFPQQQRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ADQDTIR^-OH
Peptide H-ADQDTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGIIWVATEGALNTPK^-OH
Peptide H-DGIIWVATEGALNTPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IQSFLGGAPTEDLK^-OH
Peptide H-IQSFLGGAPTEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVAANIVL^TV-OH
Peptide H-AVAANIVL^TV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTP^P^V^LDSDGSYFLYSK^-OH
Peptide H-TTP^P^V^LDSDGSYFLYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVEIPFNSTNK^-OH
Peptide H-IVEIPFNSTNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QSHLSLCRWCCNCCHNKGCGFCCKF-NH2
Peptide Ac-QSHLSLCRWCCNCCHNKGCGFCCKF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSDYFKPFSTGK^-OH
Peptide H-YSDYFKPFSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Gly-Gly-His-Gly-OH
CAS:H-Gly-Gly-His-Gly-OH is a tripeptide with a molecular weight of 778.09 g/mol. It is crosslinked to the side chain of lysine residues and can be used for the crosslinking of protein fibers, such as wool or silk, to form hydrophobic materials that are both resistant to shrinkage and have good thermal stability. The crosslinking reaction can be achieved by either the hypobromous acid oxidation or by inorganic oxidants such as hydrogen peroxide. H-Gly-Gly-His-Gly-OH has axial reactive radicals at its center which facilitates the formation of covalent links with other molecules.br> br> The yield depends on the type of reactant used and ranges from 47% (hydrogen peroxide) to 60% (hypobromous acid). The residue obtained after hydrolysis is an alpha amino acid consisting ofFórmula:C12H18N6O5Pureza:Min. 95%Forma y color:PowderPeso molecular:326.31 g/molH-VIFDANAPVAVR^-OH
Peptide H-VIFDANAPVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H75N11O11Peso molecular:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IEIYPTSLTK^-OH
Peptide H-IEIYPTSLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
