Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29809 productos de "Péptidos"
H-GAGSSEPVTGLDAK^-OH
Peptide H-GAGSSEPVTGLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-MNFLLSWVHWSLALLLYLHHAKWSQA-OH
Peptide LCBiot-MNFLLSWVHWSLALLLYLHHAKWSQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WRWYRGGRYWRW-NH2
Peptide H-WRWYRGGRYWRW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLVK^-OH
Peptide H-GLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser-Leu-Ile-Gly-Arg-Leu-NH2
Peptide H-Ser-Leu-Ile-Gly-Arg-Leu-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:656.83 g/molH-TEFTTALQR^-OH
Peptide H-TEFTTALQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-GFLTEYVAT-OH
Peptide Biot-GFLTEYVAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,765.1 g/molH-LLLLGAGESGK^-OH
Peptide H-LLLLGAGESGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GP120 - W61D - 120
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,784 g/molMethyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2
Peptide Methyltetrazine-IWLTALKFLGKHAAKHEAKQQLSKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYSIFSYATK^-OH
Peptide H-GYSIFSYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^PGF-OH
Peptide H-RP^PGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[Arg8]-Vasopressin
CAS:Arginine vasopressin (AVP) is an anti-diuretic peptide. It regulates extracellular fluid volume and electrolyte homeostasis.Fórmula:C46H65N15O12S2Peso molecular:1,084.23 g/molH-AEEGDLLVNPDQPR^-OH
Peptide H-AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KVEKIGEGTYGVVYK-NH2
Peptide H-KVEKIGEGTYGVVYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IESPGYLTSPGYPHSYHPSEK^-OH
Peptide H-IESPGYLTSPGYPHSYHPSEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LRLRGG-NH2
Peptide Ac-LRLRGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AYATEPHAK^-OH
Peptide H-AYATEPHAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuromedin (U8), porcine
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C54H78N16O10Peso molecular:1,111.32 g/molH-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKWERPFEVK^-OH
Peptide H-GKWERPFEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Polylysine
Peptide Polylysine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C60H122N20O11Peso molecular:1,299.77 g/molH-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QQTVTLLPAADLDDFSK^-OH
Peptide H-QQTVTLLPAADLDDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cecropin A
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C136H233N33O29Peso molecular:2,794.55 g/molLCBiot-GTAG-OH
Peptide LCBiot-GTAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Recombinant Human Parathyroid Hormone aa7-84/Nitrogen-15
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C381H629N119O115S2Peso molecular:8,781.05 g/molProstatic Acid Phosphatase (248 - 286), PAP (248 - 286)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C203H342N60O54S2Peso molecular:4,551.5 g/molAc-KKRYSREFLLGF-NH2
Peptide Ac-KKRYSREFLLGF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 108
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,629.9 g/molH-LGTLLPLQK^-OH
Peptide H-LGTLLPLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 102
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,777.1 g/molMyr-GRTGRRNAI-NH2
Peptide Myr-GRTGRRNAI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-RRYQNSTEL-OH
Peptide Fluor-RRYQNSTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 86 (QYDPVAALFFFDIDL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,774 g/molH-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Fórmula:C258H401N79O78Peso molecular:5,857.5 g/molH-AGFAGDDAPR^^-OH
Peptide H-AGFAGDDAPR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-YGGFL-OH
Peptide Fluor-YGGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-SSIEFARL-OH
Peptide Fluor-SSIEFARL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CDK2
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C35H57N15O9Peso molecular:831.92 g/molH-TANDLNLLILR^-OH
Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Val-Rink-Amide MBHA Resin
Fmoc-Val-Rink-Amide MBHA Resin is a peptide synthesis support resin based on polystyrene. This resin is used for the synthesis of peptides and other molecules that are less than 10 amino acids in length. The Fmoc group, which is attached to the resin, can be removed by the acid treatment of trifluoroacetic acid (TFA) or formic acid (FA). It can also be cleaved with hydrogen fluoride in order to remove side chain protecting groups.Pureza:Min. 95%Ac-KIRLRPGGK-NH2
Peptide Ac-KIRLRPGGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DAEFRHDSGYEVHHQK^-OH
Peptide H-DAEFRHDSGYEVHHQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDNSLK^-OH
Peptide H-YDNSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN gp160 Fragment 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:2,261.8 g/molLeu-Val-Val-Val-Gly-Ala-Cys-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C36H65N9O10S1Peso molecular:816.02 g/molH-MAERPEDLNLPNAVC-NH2
Peptide H-MAERPEDLNLPNAVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SNKDRHIDSSC-NH2
Peptide Ac-SNKDRHIDSSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-WSLGYTG-OH
Peptide LCBiot-WSLGYTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-ELNNN-NH2
Peptide Ac-ELNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 24 (NVHNPTGRSICPSQE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,638.8 g/molH-HEAWITLEK^-OH
Peptide H-HEAWITLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 6 (HVLKAVFSRGDTPVL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,638.9 g/molSIVmac239 - 38
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,769.1 g/molH-ASSIIDEL^FQDR-OH
Peptide H-ASSIIDEL^FQDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LALDNGGLAR^-OH
Peptide H-LALDNGGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GTPase NRas (55-64)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolIntermedin / Adrenomedullin-2 (Human) - I-125 Labeled
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-YLGEEYVK^^-OH
Peptide H-YLGEEYVK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SACRNLFG-NH2
Peptide Ac-SACRNLFG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VNVEDAGGETLGR^^-OH
Peptide H-VNVEDAGGETLGR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
pE-RPRLSHKGPMPF-OH
Peptide pE-RPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:1,533.82 g/molBenzoyl-Nle-Lys-Arg-Arg-AMC
CAS:Benzoyl-Nle-Lys-Arg-Arg-MCA is a peptide that inhibits the activity of the enzyme acetylcholinesterase (AChE) in the body. It is used to treat fever and other symptoms caused by infection with a virus, such as influenza A or B. This peptide binds to an active site on AChE, which is required for the hydrolysis of acetylcholine, thereby blocking the release of this neurotransmitter from cholinergic nerve endings. As a result, this drug may cause side effects such as nausea, vomiting, diarrhea and muscle cramps.Fórmula:C41H60N12O7Pureza:Min. 95%Peso molecular:832.99 g/molAc-CETVSTQELYS-NH2
Peptide Ac-CETVSTQELYS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Thr-Met-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C15H29N3O5S1Peso molecular:363.47 g/molAc-DIEVLQEQIRC-NH2
Peptide Ac-DIEVLQEQIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFEPTLEALFGK^-OH
Peptide H-GFEPTLEALFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,618.9 g/molAra h1 (555-577) peanut allergen
Ara h 1 is one of the major allergenic proteins from peanut (Arachis hypogaea) which contains approximately 13 potential allergenic proteins.Ara h 1 is a member of the 7/8 S globulin (vicilin) family of seed storage proteins belonging to the cupin superfamily and is the most abundant allergen present in the peanut kernel. Ara h 1 plays an important role in the allergy sensitising procedure and can be recognised by 90% of patients with a peanut allergy.This peptide represents a tryptic peptide of Ara h 1.Pureza:Min. 95%Forma y color:PowderPeso molecular:1,375.7 g/molNeuropeptide Y, human, rat
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C189H285N55O57S1Peso molecular:4,271.74 g/molH-SGPPGLQGR^-OH
Peptide H-SGPPGLQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELAFNLPSR^-OH
Peptide H-ELAFNLPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LREQLGPVTQEFWDNLEK^-OH
Peptide H-LREQLGPVTQEFWDNLEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Val-Phe-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C19H29N3O4Peso molecular:363.45 g/molH-GTVGGYFL^AGR^-OH
Peptide H-GTVGGYFL^AGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTLTAAITTVLAK^-OH
Peptide H-TTLTAAITTVLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QTALVELVK^-OH
Peptide H-QTALVELVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FDEQLPIK^-OH
Peptide H-FDEQLPIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-TLNF-OH
Peptide Ac-TLNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-LSEARNQSEL-OH
Peptide pE-LSEARNQSEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AYNVTQAFGR^-OH
Peptide H-AYNVTQAFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
BID amide
BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID). Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.Forma y color:PowderH-HLSVNDLPVGR^-OH
Peptide H-HLSVNDLPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 89 (IDLLLQRGPQYSEHP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,766 g/molH-FALPQYLK^-OH
Peptide H-FALPQYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C49H74N10O11Peso molecular:979.18 g/molCMVpp65 - 27 (SQEPMSIYVYALPLK)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,739.1 g/molH-ILSPFLPLL^-OH
Peptide H-ILSPFLPLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RWKFGGFK^WR-OH
Peptide H-RWKFGGFK^WR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Thr-Val-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C14H27N3O5Peso molecular:317.38 g/molH-VGGNYNYLYR^-OH
Peptide H-VGGNYNYLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PQNLLLDPDTAVLK^-OH
Peptide H-PQNLLLDPDTAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 54
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.9 g/molInsulin 1 precursor [57-85]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:3,121.41 g/molHXB2 gag NO-22/aa85 - 99
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,790.1 g/molBiot-PICTF-OH
Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DSALGFLR^-OH
Peptide H-DSALGFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Arg8]-Vasopressin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50241.webp&w=3840&q=75)
![Insulin 1 precursor [57-85]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50310.webp&w=3840&q=75)
