Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29708 productos de "Péptidos"
H-PSKPSKRSFIEDLLF-OH
Peptide H-PSKPSKRSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C82H128N20O22Peso molecular:1,764.03 g/molH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLLQLLIGL-OH
Peptide H-SLLQLLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H82N10O11Peso molecular:969.22 g/molH-DVDAAYMNK-OH
Peptide H-DVDAAYMNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C43H65N11O15SPeso molecular:1,026.12 g/mol5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molH-LPDPSKPSKRSFIED-OH
Peptide H-LPDPSKPSKRSFIED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C76H120N20O24Peso molecular:1,715.9 g/molDabcyl-AETFYVDG-Edans
Peptide Dabcyl-AETFYVDG-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Creolimax secretome peptide fragment
Creolimax secretome is a collection of proteins secreted by marine organism Creolimax fragrantissima. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H80N10O15Peso molecular:1,031.2 g/molHLA-E binding peptide
HLA-E binding peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C44H78N12O11Peso molecular:969.18 g/molAc-Rpw-NH2
Peptide Ac-Rpw-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIINFEKL^-OH
CAS:Peptide H-SIINFEKL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:970 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLHVTYVPAQEKNFT-OH
Peptide H-FLHVTYVPAQEKNFT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C85H122N20O22Peso molecular:1,794.01 g/molSH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C66H97N12O24PPeso molecular:1,473.57 g/molLCBiot-VLPQDKEYYKVKEPGE-NH2
Peptide LCBiot-VLPQDKEYYKVKEPGE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLASVSTVLTSK^-OH
Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGDNNL^TRIVGGQE-OH
Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLFSVHWPPLKA-NTBiot
Peptide H-YLFSVHWPPLKA-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
KRASᴳ¹²ᴰ peptide
KRASᴳ¹²ᴰ peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C38H67N11O10SPeso molecular:888.09 g/molH-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAPHGVVFL-OH TFA salt
Peptide H-SAPHGVVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C44H65N11O10Peso molecular:926.07 g/molH-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molH-SCDKTHTCPPCPAPELLGGPSVFLFPPKPK-OH
Peptide H-SCDKTHTCPPCPAPELLGGPSVFLFPPKPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C144H221N35O38S3Peso molecular:3,164.72 g/molH-FVNEEAL^R-OH
Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSVLTVLHQDWL^NGK^-OH
Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.β-Casomorphin (1-5) (bovine) acetate salt
CAS:β-Casomorphin (1-5) (bovine) acetate salt is a bioactive peptide, which is derived from the enzymatic breakdown of bovine casein, a milk protein. This peptide fragment exhibits a sequence-specific opioid-like activity, primarily due to its interaction with opioid receptors in the central nervous system. The mode of action involves mimicking the endogenous opioids by binding to these receptors, which can modulate pain perception, gut motility, and potentially impact mood and immune responses.Due to its physiological effects, β-Casomorphin (1-5) is of significant interest in scientific research focusing on its potential implications in gastrointestinal functions, neurochemical pathways, and its controversial role in conditions such as autism spectrum disorders and schizophrenia. It is also studied for its potential impact on dietary practices and the digestive processes associated with dairy consumption. Research continues to explore its pharmacokinetics, receptor affinities, and broader biological effects within dietary contexts and therapeutic frameworks.Fórmula:C30H37N5O7Pureza:Min. 95%Peso molecular:579.65 g/molFluor-RRGG-OH
Peptide Fluor-RRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 101
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,812.1 g/molMYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-SFGWDLAK^-OH
Peptide H-SFGWDLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAIIGLMV^GG-OH
Peptide H-GAIIGLMV^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MHC I-Strep HLA-A*0201 Prame
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LASGVPSR^-OH
Peptide H-LASGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSVLTV^LHQDWLNGK^-OH
Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (73 - 83)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C58H94N16O20Peso molecular:1,335.6 g/molBiot-GRSRSRSRSRSR-NH2
Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 169
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:2,058.5 g/molH-SYSMEHFR^-OH
Peptide H-SYSMEHFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pal-LPQDKEYYKVKEP-OH
Peptide Pal-LPQDKEYYKVKEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Lys(Boc)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Lys(Boc)-Wang resin is an acid-labile resin that is used as a solid support for peptide synthesis. It can be cleaved with TFA, HF, and HBr to release the polymeric product.Pureza:Min. 95%Ac-QMNQIQSVEV-OH
Peptide Ac-QMNQIQSVEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQLTPLIK^-OH
Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Gly-Rink-Amide MBHA Resin
Fmoc-Gly-Rink-Amide MBHA Resin is a resin for the synthesis of peptides. It is an ester of glycerol and a resin with a high content of amine groups. The product can be used as a building block for the synthesis of peptides, which are biologically active molecules that are composed of amino acids. Fmoc-Gly-Rink-Amide MBHA Resin has been shown to have good binding properties to both Cys and Met residues, which are two important amino acids in peptides. This product can be used to synthesize proteins that contain up to six residues at one time.Pureza:Min. 95%Ac-SSTGSIDMVD-OH
Peptide Ac-SSTGSIDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IFVGGLSPDTPEEK^-OH
Peptide H-IFVGGLSPDTPEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CHHHHHH-OH PAB-402-60F
Peptide Ac-CHHHHHH-OH PAB-402-60F is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GTVNLTWSR^-OH
Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HAIYPRH-OH
Peptide Ac-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cy5-KAPAR-OH
Peptide Cy5-KAPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^YIHP^F^HL-OH
Peptide H-V^YIHP^F^HL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Human Papillomavirus E7 protein (49 - 57)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C52H77N15O13Peso molecular:1,120.29 g/molLCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2
Peptide LCBiot-AHGVTSAPDTRPAPGSTAPPA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRDTDLPFELRGELV-NH2
Peptide H-CRDTDLPFELRGELV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-HMRSAMSGLHLVKRR-OH
Peptide LCBiot-HMRSAMSGLHLVKRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
gp100 (209-217)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C47H74N10O14SPeso molecular:1,035.2 g/molAsp-Asn-Glu-Asn-Val-Val-Asn-Glu-Tyr-Ser-Ser-Glu-Le
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H113N19O32Peso molecular:1,768.79 g/molSIVmac239 - 89
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,441.7 g/molLauric Acid-NPSSLFRYLPSD-OH
Peptide Lauric Acid-NPSSLFRYLPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Human PTH (7-34) protein, Unconjugated
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3.38 g/molAc-PKKKRKVEDPYC-OH
Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-ILRTQESEC-NH2
Peptide Ac-ILRTQESEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IWIAQELRRIGDEFNAYYARR-NH2
Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide Y (free acid) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C189H284N54O58S1Peso molecular:4,272.8 g/molBiot-KKLNRTLSFAEPG-NH2
Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Sex pheromone, iCF10
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C40H67N7O9Peso molecular:790 g/molH-KVLEYVIK^V-OH
Peptide H-KVLEYVIK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNIPTDVLK^-OH
Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-SLLQHLIGL-OH
Peptide H-SLLQHLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Protein Kinase A Substrate
Peptide Protein Kinase A Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C34H64N14O11Peso molecular:844.97 g/molAc-CDYEFEKHINLDQ-NH2
Peptide Ac-CDYEFEKHINLDQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QL^DAYPSGAW-OH
Peptide H-QL^DAYPSGAW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSITGTYDLK^-OH
Peptide H-LSITGTYDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALAEHGIVFGEPK^-OH
Peptide H-ALAEHGIVFGEPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-SVQGMSQDPVAVAASNNPEL-OH
Peptide 5Fam-SVQGMSQDPVAVAASNNPEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-IRYCWLRR-NH2
Peptide Biot-IRYCWLRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-WSASALAKI-OH
Peptide Ac-WSASALAKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-V^T^SGSTST^SR^-OH
Peptide H-V^T^SGSTST^SR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTPQAFSHFTFER^-OH
Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,740 g/molH-SSIMR^-OH
Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPEGVPPLLVSQQAK^-OH
Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALP^AP^IEK^-OH
Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQVFDVGPR^-OH
Peptide H-GQVFDVGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGIEEFLR^-OH
Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HIATNAVLFFGR^-OH
Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 104
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.1 g/molH-QLLAPGNSAGAFLIR^-OH
Peptide H-QLLAPGNSAGAFLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DRVYI^HPFHLVI-OH
Peptide H-DRVYI^HPFHLVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISTLNSHNLPILR^-OH
Peptide H-ISTLNSHNLPILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Trp63,Trp64)-C3a (63-77)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C86H134N26O18Peso molecular:1,820.17 g/molSIVmac239 - 35
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,621.9 g/molCMVpp65 - 48 (PTKDVALRHVVCAHE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,675 g/mol
