Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29631 productos de "Péptidos"
[D-Ala2,Leu5,Arg6] Enkephalin
Catalogue peptide; min. 95% purity
Fórmula:C35H51N9O8Peso molecular:725.85 g/molBiotin-a-CGRP (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C172H276N52O54S3Peso molecular:4,032.63 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
γ-TAC4 (30-61)-NH2
Catalogue peptide; min. 95% purity
Fórmula:C155H242N40O49SPeso molecular:3,481.96 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Fórmula:C262H403N79O76S3Peso molecular:5,971.67 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Fórmula:C23H28N4O4Peso molecular:424.50 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Fórmula:C61H105N23O21SPeso molecular:1,528.72 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Fórmula:C23H33N5O9Peso molecular:523.55 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Fórmula:C116H161N27O32S4Peso molecular:2,573.99 g/molα-Mating Factor (1-6)
Catalogue peptide; min. 95% purity
Fórmula:C45H59N11O8Peso molecular:882.04 g/molNps-Val-OH·DCHA
CAS:Producto controladoPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C11H14N2O4S·C12H23NPureza:Min. 95%Peso molecular:451.62 g/molRef: 3D-FN107891
Producto descatalogadobeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Fórmula:C147H227N39O43SPeso molecular:3,260.75 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Fórmula:C36H49N7O7SPeso molecular:723.91 g/molP60c-src Substrate II, Phosphorylated
Catalogue peptide; min. 95% purity
Fórmula:C33H45N6O12PPeso molecular:748.8 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Fórmula:C216H371N75O59S6Peso molecular:5,155.22 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%Ref: 3D-FF111724
Producto descatalogadoBTK derived peptide
Catalogue peptide; min. 95% purity
Fórmula:C72H115N17O18S2Peso molecular:1,570.95 g/molAdrenomedullin (1-52), human
Catalogue peptide; min. 95% purity
Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Fórmula:C28H53N7O8Pureza:Min. 95%Peso molecular:615.76 g/molRef: 3D-FS108741
Producto descatalogadobeta-Interleukin II (44-56)
Catalogue peptide; min. 95% purity
Fórmula:C68H113N19O19Peso molecular:1,500.77 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Fórmula:C215H357N71O67SPeso molecular:5,040.74 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Fórmula:C104H159N29O31Peso molecular:2,311.60 g/molZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C36H39F3N6O13SPureza:Min. 95%Peso molecular:852.79 g/molRef: 3D-FA110597
Producto descatalogadoCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C69H113N23O23•(C2HF3O2)4Pureza:Min. 95%Peso molecular:2,088.86 g/molRef: 3D-BC184180
Producto descatalogadoH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Fórmula:C49H75N9O11Peso molecular:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Fórmula:C40H62N12O9•(C2HF3O2)xPureza:Min. 95%Forma y color:PowderPeso molecular:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C48H76N12O13SPeso molecular:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C65H110N10O16Pureza:Min. 95%Peso molecular:1,287.65 g/mol
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
