Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29681 productos de "Péptidos"
Substance P acetate salt
CAS:The Substance P acetate salt is a white or off-white crystalline powder. It is soluble in ethanol and methanol, sparingly soluble in water, and insoluble in ether. The Substance P acetate salt has been widely used as a research chemical and building block for the synthesis of complex compounds. The CAS number for the substance is 137348-11-9.Fórmula:C63H98N18O13S·C2H4O2Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:1,407.68 g/molH-VTSPNITVTLK^-OH
Peptide H-VTSPNITVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GQVGRQLAIIGDDINR-NH2
Peptide Ac-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLEDVFSK^-OH
Peptide H-HLEDVFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Chorionic Gonadotropin-β (109-145) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C167H264N46O58S1Peso molecular:3,876.27 g/molH-LLVVYPWTQR^^-OH
Peptide H-LLVVYPWTQR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STSGGTAALGCL^VK-OH
Peptide H-STSGGTAALGCL^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Trp-Lys-Tyr-Met-Val-Met-NH2
CAS:H-Trp-Lys-Tyr-Met-Val-Met-NH2 is a natural compound that belongs to the group of pharmacological agents. It has been shown to have a therapeutic effect on congestive heart failure, bowel disease and autoimmune diseases. This compound has also been shown to stimulate locomotor activity in mice by increasing dopamine levels in the brain. H-Trp-Lys-Tyr-Met-Val-Met NH2 has been found to inhibit the growth of HL60 cells in culture, which are a type of white blood cell that is involved in immune response. H-Trp-Lys Tyr Met Val Met NH2 also binds to receptors for formyl and sesquiterpenoid lactones, which are chemical compounds that are used as pharmacological agents for cancer therapy and treatment of inflammatory bowel disease.Fórmula:C41H61N9O7S2Pureza:Min. 95%Peso molecular:856.11 g/molAc-CSHRKSLPKAD-OH
Peptide Ac-CSHRKSLPKAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Max-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C107H201N29O21Peso molecular:2,230 g/molH-DPGSAAPYLK^-OH
Peptide H-DPGSAAPYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRHDS-NH2
Peptide H-FRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAFGYPS-NH2
Peptide H-YAFGYPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSITGTYDLK-OH
Peptide H-LSITGTYDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H83N11O17Forma y color:PowderPeso molecular:1,110.26 g/molPhe-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C19H29N3O5Peso molecular:379.45 g/molTirzepatide
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Fórmula:C225H348N48O68Pureza:Min. 95%Forma y color:PowderPeso molecular:4,813 g/molH-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys18[(AEEA)2-5-FITC]-Hepcidin (Human)
Lys18[(AEEA)2-5-FITC]-Hepcidin (Human) is a FITC-Labeled Hepcidin for cell detection by flow cytometry and by fluorescent or confocal microscopy. Human Hepcidiin is a peptide hormone that is produced by the liver and is heavily involved in iron homeostasis through binding to and preventing ferroportin from exporting iron. Hepcidin has also demonstrated its capabilites as an anti-microbial peptide, preventing the amount of iron available to invading pathogens. This product consists of the following disulfide Bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14- Cys22 One-Letter Formula: DTHFPICIFCCGCCHRSK(AEEA-AEEA-5-FITC)-CGMCCKTFórmula:C146H203N37O42S10Pureza:Min. 95%Peso molecular:3,469.11 g/molH-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Asp(2-ClTrt-Resin)-OtBu (α Ester)
H-Asp(2-ClTrt-Resin)-OtBu (α Ester) is a building block that is used in peptide synthesis. It can be resubstituted with the amino acid, aspartic acid, and used in the formation of peptides. This resin is insoluble in water and soluble in dichloromethane and dimethylformamide. The H-Asp(2-ClTrt-Resin)-OtBu (α Ester) can also be used to form disulfides or thioethers.Pureza:Min. 95%Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) is a resin that contains amines and thiols. It can be used as a building block of peptides and proteins. H-Trp(Boc)-2-ClTrt-Resin (200-400 mesh) can also be used in the synthesis of alcohols, which are important chemicals for industry.
Pureza:Min. 95%Presenilin 1 (349-361)
Presenilin 1 (349-361) is a peptide that is a substrate for glycogen synthase. It is cleaved from the precursor protein presenilin 1 and has a molecular weight of 4.5 kDa. Presenilin 1 (349-361) is an enzyme substrate that can be used in biochemical assays to research glycogen metabolism.Fórmula:C56H93N21O19Pureza:Min. 95%Peso molecular:1,364.49 g/molH-VPEPCHPK^-OH
Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Acetyl-TGF-β 2-LAPbeta (259- 269)
Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.Forma y color:PowderPeso molecular:1,267.6 g/mol[Sar1]-Angiotensin II
CAS:Producto controladoAngiotensin II is a peptide hormone that is secreted by the kidneys. It stimulates the release of aldosterone and causes vasoconstriction, leading to an increase in blood pressure. Angiotensin II is also involved in other physiological functions such as the regulation of fluid balance, electrolyte levels, and blood coagulation. The drug is used to treat congestive heart failure and high blood pressure. Sar1-Angiotensin II has been shown to inhibit transcriptional regulation by binding to the angiotensin receptor type 1 (AT1). This binding disrupts conformational changes in the receptor, preventing signal transduction from occurring and decreasing the activity of enzymes such as protein kinase A, which are needed for activation of transcription factors.Fórmula:C49H71N13O10•(C2H4O2)2Pureza:Min. 95%Peso molecular:1,122.28 g/molPurotoxin-1
CAS:Purotoxin-1 is a peptide that belongs to the group of activators. It is an inhibitor of potassium channels which are involved in the regulation of excitability and repolarization of cells. Purotoxin-1 has been shown to block the binding of calcium ions to the N-type voltage-gated calcium channels, leading to decreased intracellular calcium levels and reduced neurotransmitter release. Purotoxin-1 has been shown to inhibit tumor growth in vivo, which may be due to its ability to inhibit protein interactions with cell surface receptors.Fórmula:C155H248N50O48S8Pureza:Min. 95%Peso molecular:3,836.5 g/molAbz-Ser-Pro-Tyr(NO2)-OH
Abz-Ser-Pro-Tyr(NO2)-OH is a peptide that has been shown to be an angiotensin I converting enzyme II (ACE) substrate and an inhibitor of ACE. It also inhibits the release of renin from the juxtaglomerular apparatus, which is needed for the production of angiotensin II. This peptide is used in biochemical research and as a standard for measuring enzymatic activity.Fórmula:C24H27N5O9Pureza:Min. 95%Peso molecular:529.51 g/molFmoc-Asp(OtBu)-Rink-Amide MBHA Resin
Fmoc-Asp(OtBu)-Rink-Amide MBHA Resin is a building block for peptides. It is an acid labile resin that can be cleaved with TFA to provide amine-protected dipeptides and tripeptides. This product is used as a building block for peptide synthesis.
Pureza:Min. 95%Fmoc-Thr(tBu)-Rink-Amide MBHA Resin
Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is a resin that can be used for the synthesis of peptides. It is an inhibitor of Protein interactions, Activator, Ligand, and Receptor. This resin can be used in research to study ion channels and antibodies. Fmoc-Thr(tBu)-Rink-Amide MBHA Resin is also a high purity product with CAS No.Pureza:Min. 95%Fmoc-Met-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Met-Wang Resin (100-200 mesh) 1% DVB is a resin that has been synthesized by the Fmoc group. The resin is used to attach peptides, proteins and other organic molecules to a solid support for use in research. The resin is also an activator of ligands and can be used as a receptor for the binding of antibodies. The resin has high purity and is made from methacrylate polymer. It contains no detectable levels of hydroquinone and 4-Vinylpyridine. Fmoc-Met-Wang Resin (100-200 mesh) 1% DVB can be used as a research tool in cell biology, immunology, pharmacology, protein interactions, receptor binding, ion channel activation and more. CAS No.: 58897-27-6Pureza:Min. 95%H-Phe-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Phe-2-ClTrt-Resin (100-200 mesh) 1% DVB is a building block that is used in peptide synthesis. It has been shown to react with amines and thiols, as well as alcohols, yielding a resin that can be used for the protection of amino acids during peptide synthesis. This product is supplied as a dry powder containing 1% DVB, 100 to 200 mesh.
Pureza:Min. 95%ACTH (1-13), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H106N20O19SPeso molecular:1,623.9 g/molH-ETIEIETQVPEK^-OH
Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VASLR^-OH
Peptide H-VASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C80H138N26O24S2Peso molecular:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,776.1 g/molFmoc-Arg(Pbf)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Arg(Pbf)-Wang resin is a building block for the synthesis of peptides. It is a resin that is used for the solid phase synthesis of peptides and oligonucleotides with Fmoc chemistry. This resin is provided in powder form, as well as in various particle sizes from 100 to 200 mesh. The resin has been shown to be stable in the presence of DIC/HOBT coupling reactions and can be used with other resins for automated peptide synthesizers.Substitution: 0.3meq/gSwelling: 4.4ml/g (DCM - 30min)Pureza:Min. 95%(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Forma y color:PowderPeso molecular:4,309.86 g/molH-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Ala-Wang Resin (100-200 mesh) 1% DVB
This is a vivitide catalogue product. Please send your vivitide product enquiry to sales@vivitide.com for an up-to-date price and availability.Pureza:Min. 95%Suc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C32H40N6O9Peso molecular:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Ser(tBu)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is designed for the synthesis of peptides. It can be used as a building block and has been shown to react with thiols, alcohols, amines, and other building blocks.Pureza:Min. 95%Ac-Arg-[Cys-Met-Ava-Arg-Val-Tyr-Ava-Cys]-NH2
Ac-Arg-[Cys-Met-Ava-Arg-Val-Tyr-Ava-Cys]-NH2 is a peptide that has antagonist activity against melanin, the hormone receptor. This peptide can be used to treat skin pigmentation disorders such as vitiligo, which is an autoimmune disorder in which the melanocytes are destroyed. Ac-Arg-[Cys-Met-Ava-Arg-Val-Tyr-Ava-Cys]-NH2 is also an aminovaleric acid derivative, which can inhibit the production of aminovaleric acid and related compounds.Fórmula:C49H82N16O11S3Pureza:Min. 95%Peso molecular:971.22 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFmoc-β-(7-methoxy-coumarin-4-yl)-Ala-OH
CAS:Fmoc-b-(7-methoxy-coumarin-4-yl)-Ala-OH is a reagent with the CAS No. 524698-40-6, which is used in organic synthesis. It is a versatile building block and useful intermediate that can be used to synthesize other organic compounds. Fmoc-b-(7-methoxy-coumarin-4-yl)-Ala-OH is also used as a reaction component in the synthesis of peptides and proteins, as well as in the preparation of polymers. It has been shown to be an effective building block for complex compounds.Fórmula:C28H23NO7Pureza:Min. 95%Forma y color:PowderPeso molecular:485.48 g/molH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molH-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone-H2A-(107-122)-Ac-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C81H140N20O23Peso molecular:1,762.1 g/molH-YPLIQTLR^-OH
Peptide H-YPLIQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C42H74N10O12SPeso molecular:943.18 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C99H155N31O23Peso molecular:2,147.5 g/molCyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFEILSPVYR^-OH
Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Rhodopsin Epitope Tag
ID4 is a highly versatile epitope tag. The peptide sequence is highly specific to rhodopsin and related photoreceptor proteins, meaning when used with monoclonal antibodies off-target signals are virtually non-existent. ID4 is also devoid of charged residues therefore reducing nonspecific ionic interactions. Monoclonal antibodies also bind to ID4 with high affinity therefore there is less need for inserting multiple copies of ID4.Peso molecular:902.4 g/molMotilin (1-10)
Residues 1-10 of the gastrointestinal hormone motilin, secreted from endocrine cells in the small intestines, mainly from the jejunum and duodenum, in response to the fasting, drinking water or the mechanical stimulus of eating.Peso molecular:1,184.6 g/molH-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neurokinin A (Substance K)
Neurokinin A (NKA) is a member of the classical tachykinins family of peptides which also includes substance P and neurokinin B. These peptides are primarily found in the nervous system where they act as neurotransmitters and neuromodulators. They also play key roles in neuronal inflammation, and high levels of NKA have been linked to poor prognosis of some tumours.The tachykinin peptides are characterised by a common C-terminal sequence, Phe-X-Gly-Leu-Met-NH2, where X represents either an aromatic (Phe, Tyr) or a branched aliphatic (Val, Ile) amino acid.This C-terminal region is thought to be responsible for activating the receptor. The divergent N-terminal region is thought to play a role in determining the receptor subtype selectivity. NKA binds preferentially to the NK2 receptor.Peso molecular:1,132.6 g/molH-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CSK substrate
Substrate peptide for C-terminal Src kinase (Csk) for use in kinase assays. Csk is a cytosolic tyrosine kinase that is closely related to the kinase Src and is a well-known negative regulator of Src family kinases. Csk has both tumour suppressor and oncogenic properties and has also been implicated in regulating blood pressure, making Csk a novel therapeutic target for hypertension disorders.
Forma y color:PowderPeso molecular:1,504.8 g/molTetanus Toxin (1084-1099)
Tetanus Toxin (1084-1099) is a protein that is derived from the single-chain polypeptide neurotoxin produced by Clostridium tetani. The neurotoxins produced by Clostridium tetani are among the most potent molecules known to humankind. Once in the body, the toxin binds to the basal lamina at the neuromuscular junction. From here, the toxin is transported to inhibitory interneurons in the spinal cord, where it prevents the release of neurotransmitters, which causes spastic paralysis.Peso molecular:1,878.1 g/molHXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molDYKDDDDK FLAG peptide
Highly specific protein tag that can be added to a protein using recombinant DNA technology. FLAG is an artificial antigen to which high affinity monoclonal antibodies have been raised, therefore allowing for highly effective protein purification by affinity chromatography as well as accurate localisation of FLAG tagged proteins within living cells, or Western blots. FLAG peptide can be used to effectively purify complexes with multiple proteins as its mild purification procedure tends not to disrupt such complexes. It can be used to obtain proteins of sufficient purity for x-ray crystallography.Peso molecular:1,012.4 g/mol(Arg8) Vasotocin
(Arg8) Vasotocin (AVT) is a member of the neurohypophyseal hormone family which contains 9 amino acids with the cysteines at positions 1 and 6 linked through a disulphide bridge. Within the central nervous system of lower vertebrates, AVT has been shown to play a role as a neuromodulator and controls reproductive behaviour. Furthermore it regulates osmotic and electrolyte balance and blood pressure within the periphery. In the mammalian brain AVT functions through arginine vasopressin (AVP) or oxytocin receptor cross-reactions. Mice have an AVT reactive receptor specific to AVT and neuropeptide S. This AVT which functions to regulate processes such as sleep and reproduction.Forma y color:PowderPeso molecular:1,049.5 g/molBeclin-1
The Beclin-1 peptide is derived from a region of the Beclin-1 protein, which interacts with a newly identified negative regulator of autophagy, GAPR-1 (also called GLIPR2) to act as a potent inducer of autophagy. Autophagy is an essential process that maintains cellular homeostasis and carries out lysosome-mediated degradation of unwanted proteins in the cytoplasm. It is often examined when looking at disease pathways because of this regulatory function. While the immune system initiates the removal of viruses and pathogens through the autophagic pathway, some viruses (such as HIV) are able to evade this process.Peso molecular:2,064.22 g/molH-FVNEEAL^R-OH
Peptide H-FVNEEAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSVLTVLHQDWL^NGK^-OH
Peptide H-VVSVLTVLHQDWL^NGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CCK octapeptide Cholecystokinin (26-33)
CAS:The octapeptide cholecystokinin (26-33), known as CCK-8, has the full biological activity of the full-length cholecystokinin (CCK). CCK acts as a hormone and neurotransmitter and is found in the GI and central nervous systems. CCK-8 is a satiety peptide that inhibits food intake.CCK-8 can also inhibit amanitin uptake into hepatocytes.Fórmula:C49H62N10O13S2Peso molecular:1,063.21 g/molHistone H3 (1-15) K4Me3, K9Ac, pS10
Histone 3 (H3) is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter the positioning of the nucleosome, allowing the DNA it to be either available or inaccessible to the transcription machinery.The lysine at position 4 of this peptide has been tri-methylated and it is implicated in studies that this modification may remodel the chromatin so that it is more accessible to transcription factors, which may ultimately increase the level of gene expression. The lysine at position 9 has been acetylated, which neutralizes the positive charge on the amino acid, loosening the chromatin structure. This alteration to the accessibility of chromatin promotes the initiation of transcription. Moreover, the serine at position 10 has been phosphorylated, and studies have suggested that this may induce chromatin condensation, and subsequently repress transcription and gene expression.Peso molecular:1,724.9 g/molH-MDYKDHDGDYKDHDIDYKDDDDK-NH2
Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
beta-Amyloid (1-11) Biotin
β-Amyloid 1-11 (Aβ1-11) is one of many short Aβ species found in vivo and is formed by the cleavage of amyloid β precursor protein by β- and α-secretase. Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer disease (AD) and Down syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then &γ--secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Biotin is C-terminally linked to the peptide via ethylenediaminefor convenient detection and purification. Alternative β-Amyloid fragments and labels are also available, please refer to our peptide catalogue for availability.Peso molecular:1,592.7 g/molHistone H3 (32-38) K36Me2
Histone H3 (32-38) K36Me2 is derived from Histone 3 (H3) which is one of the four core histones (H2A, H2B, H3 and H4) fundamental in compacting eukaryotic DNA into the nucleosome. The nucleosome arises when 147 base pairs of DNA wrap around a H3-H4 tetramer and two H2A-H2B dimers, forming the histone octamer core. Both H4 and H3 are highly conserved and perform roles in binding to segments of DNA which enter and leave the nucleosome and in chromatin formation. Similar to the other core histone, H3 has a globular domain and a flexible N-terminal domain, 'histone tail' which can undergo modifications such as acetylation, methylation, phosphorylation and ubiquitination. Due to histones containing a large number of lysine and arginine residues they have a positive net charge which interacts in an electrostatic manner with the negatively charged phosphate groups in DNA. The transcriptional activation or silencing of the chromatin is controlled by ATP-dependent chromatin remodelling factors and histone modifying enzymes which target histone proteins. Both processes function to alter to change the positioning of the nucleosome, allowing the DNA it to be either available to the transcription machinery or inaccessible.The Histone H3 (32-38) lysine 36 has been dimethylated.
Peso molecular:713.4 g/molFluor-RRGG-OH
Peptide Fluor-RRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 101
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,812.1 g/molHSA (55-66)
The HSA (55-66) peptide is derived from human serum albumin (HSA), a protein present in the blood plasma. It is involved in the transportation of compounds through the blood stream, the maintenance of osmotic blood pressure and could be used to improve drug delivery.
Forma y color:PowderPeso molecular:1,455.7 g/molTemporin A
Temporin A is a short, linear, basic and highly hydrophobic anti-microbial peptide (AMP) isolated from the frog, Rana temporaria. Temporin A is particularly active against Gram-positive bacteria including those arranged in biofilms. Temporin A is also active against some Gram-negative bacteria and Leishmania parasites.Temporin A adopts an alpha-helical conformation in a membrane-mimicking environment and is able to perturb the membrane of microbial cells. Temporin A is practically non-haemolytic up to concentrations five-times higher than their minimum inhibitory concentration (MIC) against Gram-positive bacteria.Peso molecular:1,396.76 g/molClick Arg9
Cell penetrating peptides (CPP) are a keen area of molecule design to create the ideal vector for transporting macromolecule cargo into the cell. There is also a crossover of CPP acting as antimicrobial peptides (AMP) due to their ability to permeabilise the lipid membrane. AMPs are now being considered as a tool against the rise of antibiotic-resistant bacteria. CPPs and AMPS tend to be 10 - 30 amino acids long, cationic, and rich in arginine (R) and tryptophan (W). The presence of R and W in the backbone have been used to generate de novo CPP/AMP peptides with improved functions. Of these, nonarginine (R9) was shown to have the highest cellular uptake against other CPPs tested, lowest cytotoxicity and significant antimicrobial activity.R9 is provided here with a N-terminal alkyne attachment. Two of the most regularly encountered functional groups for click chemistry are azides and alkynes, and the azide-alkyne cycloaddition has become the most popular click reaction. The use of click chemistry with alkyne-R9 allows a wide variety of applications and has already been used for conjugation, modification and peptide design.
Forma y color:PowderPeso molecular:1,502 g/molSARS-CoV-2 NSP13 (326-340)
The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication. NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (326-340) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecular:1,694 g/molAnoplin
Antimicrobial and cytolytic peptide isolated from the venom of the spider wasp Anoplius samariensis. Anoplin has potent and board-spectrum antimicrobial activity against both Gram-positive and Gram-negative bacteria, antifungal properties against some plant pathogenic fungi, and no haemolytic activity against human erythrocytes. At 10 amino acids long, anoplin is the smallest naturally occurring antimicrobial and cytolytic peptide, its small size may have advantages for chemical manipulation and medical application.Peso molecular:1,153.5 g/molH-FL^PEFGISSA-OH
Peptide H-FL^PEFGISSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Azhx-Penetratin
Identification of cell penetrating conjugates has aided numerous areas of scientific development. The Drosophila transcription factor Antennapedia contains a homeodomain that can be internalised by cells to the cytoplasm and to the nucleus in a receptor-independent mechanism. The key residues for internalisation have been sequenced (RQIKIWFQNRRMKWKK), named penetratin, and used in several studies to aid entry of fusion proteins into cells.The full 60 amino acid homeodomain was fused to a T cell epitope of the influenza nucleoprotein and successfully internalised into T cells for presentation. The fragment known as penetratin was fused to a ligand for Grb-2 resulting in inhibition of downstream Grb-2 signalling events.- Penetratin has also been used in vivo to prime cytotoxic T lymphocytes by conjugating short antigenic peptides to the CPP. This penetratin has been synthesised with an N-terminal 6-azidohexanoic acid (Azhx) which can be used for various applications as a linker.Forma y color:PowderPeso molecular:2,384.4 g/molH-SFGWDLAK^-OH
Peptide H-SFGWDLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide
Nef is an accessory protein highly conserved amongst all primate lentiviruses, it is essential for viral replication in vivo- it is expressed by human immunodeficiency virus (HIV) HIV-1 and HIV-2.-Nef acts as a downregulator of class I human leukocyte antigens (HLA) expression in HIV-infected cells to help circumvent the immune response, such as Cytotoxic T lymphocytes (CTL) activity. An intact-nef-gene is critical for high viral loads, linked to development of acquired immunodeficiency syndrome (AIDS). Certain alleles of HLA have been associated with maintaining a seronegative status such as HLA-A*1101. This nef peptide sequence (73-82) has highly conserved residues, a study crystalised it bound within HLA-A*1101. Further investigation using this peptide sequence, with the attached acetyl group for added stability, could elucidate the nature of resistance to HIV infection and the nef residues.Peso molecular:1,272.7 g/molH-EALDFFAR^-OH
Peptide H-EALDFFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fas blocking peptide
Blocks Fas-FasL interaction, and in the Neuro2a cell model of ischemia protects against ischemic stroke-induced neuronal cell death by binding to Fas expressing cells and rescuing them from Fas mediated apoptosis.Peso molecular:1,078.4 g/molBiot-GRSRSRSRSRSR-NH2
Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![Lys18[(AEEA)2-5-FITC]-Hepcidin (Human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3793-PI.webp&w=3840&q=75)
![[Sar1]-Angiotensin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPAN-3948-PI.webp&w=3840&q=75)
![Ac-Arg-[Cys-Met-Ava-Arg-Val-Tyr-Ava-Cys]-NH2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPMC-3881-PI.webp&w=3840&q=75)
![nef peptide [Human immunodeficiency virus type 1] (73-82) acetyl/amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1001223.webp&w=3840&q=75)
