Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29635 productos de "Péptidos"
H-LVLATGLR^-OH
Peptide H-LVLATGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Leu-Gly-Pro-Lys-Acc-NH2
Ac-Leu-Gly-Pro-Lys-Acc-NH2 is a peptide that has the amino acid sequence of Leu, Gly, Pro and Lys. It is an enzyme substrate that has a high specificity for thrombin. Ac-Leu-Gly-Pro-Lys-Acc-NH2 has been shown to have a kinetic constant of 0.063/min/mg and a kinetic rate of 0.21/min when incubated with thrombin at 37°C in phosphate buffer (pH 7.4).Fórmula:C32H45N7O8Pureza:Min. 95%Peso molecular:655.76 g/molDOTA-GRRRRRRRRRRR-OH
Peptide DOTA-GRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTDEYQLYEDIGK^-OH
Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KHNLGHGHKHERDQGHGHQR-NTBiot
Peptide H-KHNLGHGHKHERDQGHGHQR-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.rec IL-4 (human)
Please enquire for more information about rec IL-4 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Pureza:Min. 95%SARS-CoV-2 Antigen Peptide NCAP (AFFGMSRIGMEVTPSGTW)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C89H132N22O25S2Peso molecular:1,974.37 g/molH-VAAEDWK^-OH
Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASFHIPQVQVR^-OH
Peptide H-ASFHIPQVQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DPGSAAPYLK^-OH
Peptide H-DPGSAAPYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRHDS-NH2
Peptide H-FRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAFGYPS-NH2
Peptide H-YAFGYPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSITGTYDLK-OH
Peptide H-LSITGTYDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H83N11O17Forma y color:PowderPeso molecular:1,110.26 g/molPhe-Ile-Thr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C19H29N3O5Peso molecular:379.45 g/molH-Pro-Phe-Arg-AMC acetate salt
CAS:Fluorogenic substrate targeting pancreatic and urinary KallikreinFórmula:C30H37N7O5·C2HF3O2Pureza:Min. 95%Forma y color:White Off-White PowderPeso molecular:575.66 g/molH-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTFEGDLK^-OH
Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[5-FAM]-IFN-γ receptor (pTyr) peptide
Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &γ- (IFN&γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&γ- is secreted by immune cells and signals through the IFN&γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tagPeso molecular:1,364.5 g/molH-ALPMHIR^-OH
Peptide H-ALPMHIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LMKNMDPLNDNV-NH2
Peptide Ac-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSFELFADK^-OH
Peptide H-VSFELFADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPEPCHPK^-OH
Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Acetyl-TGF-β 2-LAPbeta (259- 269)
Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.Forma y color:PowderPeso molecular:1,267.6 g/mol2-[[(2S)-2-[[2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino- 2-[[(2S)-2-[[(2S)-4-amino-2-[[(2S,3R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-hydroxybutanoyl]amino]-4-oxobutanoyl]amino]-4-
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C80H138N26O24S2Peso molecular:1,912.3 g/molLCBiot-EDQVDPRLIDG-OH
Peptide LCBiot-EDQVDPRLIDG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-103
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,776.1 g/mol(Pyr 3)-Amyloid β-protein (3-42)
CAS:Please enquire for more information about (Pyr 3)-Amyloid β-protein (3-42) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C196H299N53O55SPureza:Min. 95%Forma y color:PowderPeso molecular:4,309.86 g/molL-threo-Phenylserine
CAS:L-threo-Phenylserine is a naturally occurring amino acid that is synthesized in the human body. It can be found in the brain and muscles, where it is used for protein synthesis. L-threo-phenylserine has been shown to be an effective oxygen nucleophile and can catalyze the hydrolysis of hydrogen fluoride. This compound has also been shown to have biological activity in vitro as well as structural properties that are useful for conformational analysis and structural biology research. L-threo-phenylserine may also have potential medical applications, such as its use as a treatment for mental disorders and epilepsy.Fórmula:C9H11NO3Pureza:Min. 95%Forma y color:White To Off-White SolidPeso molecular:181.19 g/molAc-FAOOFAOOFOOFAOOFAOFAFAF-NH2
Peptide Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATGIPDR^-OH
Peptide H-ATGIPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSQYIEWLQK^-OH
Peptide H-VSQYIEWLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLPSDFFPSV^-OH
Peptide H-FLPSDFFPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C32H40N6O9Peso molecular:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RNQDQQGPFKMC-NH2
Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C86H129N15O24Peso molecular:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,695 g/molHistone-H2A-(107-122)-Ac-OH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C81H140N20O23Peso molecular:1,762.1 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C66H97N12O24PPeso molecular:1,473.57 g/molSRC Kinase Substrate
Peptide SRC Kinase Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C64H107N22O24PPeso molecular:1,599.69 g/molAc-CVYVRSAIQLGNYK-OH
Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGVNGFGR^-OH
Peptide H-VGVNGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (Rat)
Nesfatin-1 is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells. Nesfatin-1 (Rat) is a peptide hormone that is encoded by the NPY gene. It is found in the hypothalamus and pancreas, where it regulates appetite. Nesfatin-1 has been shown to reduce food intake in rats by activating the hypothalamic feeding center and suppressing the appetite center. It also stimulates glucose production in pancreatic beta cells and increases insulin release from pancreatic alpha cells.Fórmula:C424H684N116O136Pureza:Min. 95%Peso molecular:9,582.88 g/molH-LNILNNK^-OH
Peptide H-LNILNNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFEILSPVYR^-OH
Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYLPEPVTVTWNSGTLTNGVR^-OH
Peptide H-GYLPEPVTVTWNSGTLTNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MHRQETVDCLKKFN-NH2
Peptide H-MHRQETVDCLKKFN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALAAELNQLR^-OH
Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTVLGQPK^-OH
Peptide H-LTVLGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,775 g/molH-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMPEEGFKGTGLLGH-OH
Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
EBV LMP2 356-364 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GDVAFVK^-OH
Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SL^EDLQL^THNK^-OH
Peptide H-SL^EDLQL^THNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 21
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,758.2 g/molH-ENPVVHFFKNIVTPR-NH2
Peptide H-ENPVVHFFKNIVTPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVTVTAEALR^-OH
Peptide H-FVTVTAEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
OVA peptide (257-264) TFA salt
CAS:Ovalbumin (OVA) is the primary protein in egg-white, and is involved in initiating food allergies and asthma. It is a highly immunogenic protein and can be used for peptide conjugation in the development of antibodies.OVA (257-264) is a class I (Kb)-restricted peptide epitope of OVA. The ovalbumin fragment is presented by the class I MHC molecule, H-2Kb. Ovalbumin (257-264) chicken has been used to trigger T cell activation in immunology studies.
Sold as the TFA saltFórmula:C45H74N10O13·xC2HF3O2Forma y color:PowderPeso molecular:963.13 g/molH-LTWASHEK^-OH
Peptide H-LTWASHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YML^DLQPETT-OH
Peptide H-YML^DLQPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 14 (PSLILVSQYTPDSTP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,617.8 g/molH-SFGWDLAK^-OH
Peptide H-SFGWDLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAIIGLMV^GG-OH
Peptide H-GAIIGLMV^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MHC I-Strep HLA-A*0201 Prame
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-LASGVPSR^-OH
Peptide H-LASGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVSVLTV^LHQDWLNGK^-OH
Peptide H-VVSVLTV^LHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Histone H3 (73 - 83)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C58H94N16O20Peso molecular:1,335.6 g/molBiot-GRSRSRSRSRSR-NH2
Peptide Biot-GRSRSRSRSRSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV - 1 MN ENV - 169
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:2,058.5 g/molH-SYSMEHFR^-OH
Peptide H-SYSMEHFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKSGTGIAAMSVMRPEQ-NH2
Peptide Ac-CKSGTGIAAMSVMRPEQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGNEIQYVALR^-OH
Peptide H-VGNEIQYVALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-FSPDDSAGASALLR-OH
Peptide LCBiot-FSPDDSAGASALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IADFGLAR^-OH
Peptide H-IADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pal-LPQDKEYYKVKEP-OH
Peptide Pal-LPQDKEYYKVKEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fluor-NLVPMVATV-OH
Peptide Fluor-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VDLLNQEIEFLK^-OH
Peptide H-VDLLNQEIEFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVFVDLEPTVIDEVR^-OH
Peptide H-AVFVDLEPTVIDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QMNQIQSVEV-OH
Peptide Ac-QMNQIQSVEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQLTPLIK^-OH
Peptide H-EQLTPLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH
Peptide LCBiot-MPVDPDNEAYEMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Val-Ile-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C17H33N3O4Peso molecular:343.46 g/mol
![[5-FAM]-IFN-γ receptor (pTyr) peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100416.webp&w=3840&q=75)
