Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29634 productos de "Péptidos"
H-DINAYNCEEPTEK^-OH
Peptide H-DINAYNCEEPTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14)
Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14) is a non-Acylated Analog of Ghrelin (Human, 1-14), amino acids 1-14 of the peptide hormone Ghrelin. This peptide does not contain the unique N-octanoyl group which is linked to Ghrelin's third serine residue covalently and which allows Ghrelin to associate with the growth hormone secretagogue receptor (GHS-R). Through interaction with the GHS-R, Ghrelin can exert its various effects on the body such as stimulating appetite, nutrient sensing, meal initiation and the regulation of insulin resistance, diabetes and obesity. Its wider functions are also associated with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Fórmula:C68H106N22O23Pureza:Min. 95%Peso molecular:1,599.74 g/molZ-LLY-NH2
Peptide Z-LLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IWIAQELRRIGDEFNAYYARR-NH2
Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFFNIFTR^-OH
Peptide H-FFFNIFTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GKKPSGPNPGGNN-OH
Peptide Biot-GKKPSGPNPGGNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STQSAIDQI^TGK-OH
Peptide H-STQSAIDQI^TGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Growth hormone releasing protein-2
CAS:Please enquire for more information about Growth hormone releasing protein-2 including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C45H55N9O6Pureza:Min. 95%Forma y color:PowderPeso molecular:817.98 g/molH-LIFAGKQLEDGR^-OH
Peptide H-LIFAGKQLEDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FALL-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C217H354N62O55Peso molecular:24.7 g/molAc-DRLPKSDSEDGPRALNQLSC-NH2
Peptide Ac-DRLPKSDSEDGPRALNQLSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KITDFGRAK^-OH
Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-PKKKRKVEDPYC-OH
Peptide Ac-PKKKRKVEDPYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLVK^-OH
Peptide H-GLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAAGAFQGLR^-OH
Peptide H-VAAGAFQGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.8-Azido-3,6-Dioxaoctanoic Acid
CAS:8-Azido-3,6-Dioxaoctanoic Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 8-Azido-3,6-Dioxaoctanoic Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C6H11N3O4Pureza:Min. 95%Peso molecular:189.17 g/molH-QITIPSQEQEHSQK^-OH
Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys27(Azido), Exendin-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C189H293N52O61SPeso molecular:4,311.96 g/molAc-CQHIMAILHYFEIVQ-OH
Peptide Ac-CQHIMAILHYFEIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LVLRLRGG-OH
Peptide LCBiot-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPASPETHL^DMLR^-OH
Peptide H-LPASPETHL^DMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Gly-Gly-Gly-Gly-Arg-Gly-Asp-Tyr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H43N11O12Peso molecular:737.72 g/molH-DPLAVDK^-OH
Peptide H-DPLAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phe4,9 [Ring D5]-Hepcidin (Rat)
A Deuterium Stable Isotope-Labeled Hepcidin for use as an internal standard and in the study of the biological activity of Hepcidin. This product consists of the disulfide bonds: Cys7-Cys23, Cys10-Cys13, Cys11-Cys19, and Cys14-Cys22.Fórmula:C111H161D10N29O34S8Pureza:Min. 95%Peso molecular:2,722.37 g/molH-TL^SDYNIQK-OH
Peptide H-TL^SDYNIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVGGWECEK^-OH
Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTPQAFSHFTFER^-OH
Peptide H-LTPQAFSHFTFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFGPVDSEQLSR^-OH
Peptide H-LFGPVDSEQLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDRTSASQQSNYGKC-NH2
Peptide H-MDRTSASQQSNYGKC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVFDFSQR^-OH
Peptide H-EVFDFSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TFRRRN-NH2
Peptide H-TFRRRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
n-Octylpolyoxyethylene
CAS:n-Octylpolyoxyethylene (n-OPEO) is a synthetic surfactant that is used as an antimicrobial agent. It has been shown to be effective against a wide variety of bacteria, including Mycobacterium tuberculosis and Staphylococcus aureus. The mechanism by which n-OPEO exerts its antibacterial efficacy is not yet fully understood. It may inhibit the growth of bacteria by disrupting their cell membranes, or it may interfere with the synthesis of proteins needed for bacterial growth.Fórmula:C8H18O(C2H4O)nForma y color:Clear LiquidPeso molecular:174.28Ac-IKPDVAVSC-NH2
Peptide Ac-IKPDVAVSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CRQIKIWFQNRRMKWKK-NH2
Peptide H-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQGTFTSDYSK^YLDSRRAQDFVQWLMNTKR^NRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C192H295N61O60SPeso molecular:4,449.9 g/molSIVmac239 - 113
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,606.9 g/molAc-CQSSMDHQAPLATVT-NH2
Peptide Ac-CQSSMDHQAPLATVT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDMGDVQHFADDVIAQR^-OH
Peptide H-GDMGDVQHFADDVIAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LLVP-NH2
Peptide Ac-LLVP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GL^PAPI^EK-OH
Peptide H-GL^PAPI^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SDPNFLRF-NH2
Peptide H-SDPNFLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Vimentin , human, recombinant
Vimentin is a type II intermediate filament protein that is found in most cells. Vimentin has been shown to be an important component of the cytoskeleton and is involved in many cellular processes such as cell division, cell motility, regulation of protein synthesis, and apoptosis. Vimentin can also act as an ion channel. It has been used extensively to study the effects of ion channel blockers on the cytoskeleton.Pureza:Min. 95%Hepcidin-9 (Mouse)
Hepidin-9 (mouse), a trifluoroacetate Salt product, is a variant of the peptide hormone hepcidin-25 that is produced in mice. Hepcidin plays a critical role in regulating iron metabolism in the body by controlling the activity of ferroportin, a protein that facilitates the export of iron from cells into the bloodstream. In mice, hepcidin is primarily produced in the liver, and its expression is regulated by a variety of factors, including iron status, inflammation, and erythropoietic signals. Hepcidin has been found to play a critical role in the development of iron-related disorders in mice, including anemia and iron overload. The study of Hepcidin-9 can provided important insights into the regulation of iron metabolism in mammals and may help to inform the development of treatments for iron-related disorders in humans.Fórmula:C50H73N11O13SPureza:Min. 95%Peso molecular:1,068.27 g/molH-VVLPISIYAK^-OH
Peptide H-VVLPISIYAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASQFVGSSIHWYQQR^-OH
Peptide H-ASQFVGSSIHWYQQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GKSLYESWTKK-OH
Peptide LCBiot-GKSLYESWTKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Amyloid beta peptide(1-40) trifluoroxalate - synthetic
CAS:Amyloid beta peptide (Aβ) is a neurotrophic factor that is involved in the pathogenic mechanism of Alzheimer's disease. This drug inhibits the production of Aβ by binding to the enzyme, secretase. It has been shown that Aβ binds to a transporter protein and is transported into cells, where it accumulates in the cytoplasm. The physiological levels of Aβ are regulated by proteins called "gene chaperones" which prevent Aβ from aggregating into plaques. Dextran sulfate inhibits this process by binding to amyloid and preventing it from accumulating in the cytoplasm. Amyloid beta peptide trifluoroxalate (ATFX) has been shown to inhibit the production of Aβ with structural analysis, inhibition of cellular uptake and secretion, and inhibition of fibrillization. ATFX also has potential as a biomarker for Alzheimer's disease because it can be detected at low concentrations in urine or serumFórmula:C194H295N53O58S·C2HF3O2Pureza:Min. 95%Forma y color:White PowderPeso molecular:4,443.83 g/molHBV Seq2 aa: 179-186
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C52H70N10O10Peso molecular:995.17 g/molH-SLGPVGFMK^-OH
Peptide H-SLGPVGFMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LAAFPEDR^-OH
Peptide H-LAAFPEDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-119
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,799.1 g/molCONSENSUS B Tat - 20
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,623.9 g/molH-VLGAFSDGLAHLDNLK^-OH
Peptide H-VLGAFSDGLAHLDNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Mastoparan-T
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H129N19O15Peso molecular:1,512.9 g/molH-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phytochelatin 2 (PC2)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C18H29N5O10S2Peso molecular:539.58 g/molHistone H3 (1-25), amide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C110H202N42O32Peso molecular:2,625.1 g/molIndole-D-OH
Peptide Indole-D-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAGQDGSVVQFK^-OH
Peptide H-VAGQDGSVVQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-Ala-Ala-Pro-Abu-pNA
Suc-Ala-Ala-Pro-Abu-pNA is a peptide that has been shown to inhibit the activity of elastase, an enzyme that breaks down proteins in tissues. It is used as a substrate for enzyme assays and as a tool for studying elastase. This peptide can be used to study the structure and function of elastases, which are necessary for the breakdown of proteins in tissues.
Fórmula:C25H34N6O9Pureza:Min. 95%Peso molecular:562.58 g/molAc-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CVQHHRERKRASKSSKHSMS-OH
Peptide Ac-CVQHHRERKRASKSSKHSMS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
β Amyloid 25-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,372.65 g/molH-VSSASDYNSSELK^-OH
Peptide H-VSSASDYNSSELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPSTSGSEGVPFR^-OH
Peptide H-LPSTSGSEGVPFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.DOTA-Glu-[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2
DOTA-Glu-[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2 is a trifunctional cyclic peptide that can be derivatized with various groups such as radiolabels. It has been shown to have strong affinity for the integrin receptor and can be used for targeting of tumors. DOTA-Glu-[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2 has also been found to inhibit cell proliferation and induce apoptosis in tumor cells.Fórmula:C75H113N23O23Pureza:Min. 95%Peso molecular:1,704.88 g/molAntipain
CAS:Antipain is a protease inhibitor, which is derived from microbial sources. It inhibits serine and cysteine proteases through the formation of a reversible covalent complex with the active site of the enzyme. This interaction effectively prevents the proteolytic activity of these enzymes, thereby modulating various biological processes.The primary application of Antipain is in biochemical research where it is utilized to study protease function and regulation. By inhibiting specific proteases, researchers can investigate protein degradation pathways and decipher complex signaling mechanisms. Additionally, Antipain is used experimentally to inhibit protease activity in cell lysates, thereby preserving protein integrity during sample preparation. Its specificity for serine and cysteine proteases makes it a valuable tool for differentiating between proteolytic activities in various biological samples.Fórmula:C27H44N10O6netPureza:Min. 95%Peso molecular:604.7 g/molH-GFQSMYTFV-OH
Peptide H-GFQSMYTFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AIPVAQDLNAPSDWDSR^-OH
Peptide H-AIPVAQDLNAPSDWDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LL^-OH
Peptide H-LL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Gly-Asp-D-Tyr-Glu)
Cyclo(Arg-Gly-Asp-D-Tyr-Glu) is a peptide macrocyclic compound that has been used as a radiolabeling agent for peptides. This compound is an analogue of cyclo(Arg-Gly-Asp), which is a biologically active peptide found in many cell surface receptors. Cyclo(Arg-Gly-Asp) has been shown to have antiangiogenic and antiapoptotic properties.Fórmula:C26H36N8O10Pureza:Min. 95%Peso molecular:620.62 g/molHIV - 1 MN ENV - 141
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,782.1 g/molH-TVLDSGISEVR^-OH
Peptide H-TVLDSGISEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-IAMVD-OH
Peptide Ac-IAMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGIETPLPK^-OH
Peptide H-LLGIETPLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-GIEPFSDPMPEQ-EDDnp
Peptide Abz-GIEPFSDPMPEQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVYYPDK^-OH
Peptide H-GVYYPDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-EADPTGHSY-OH
Peptide Biot-EADPTGHSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KI^TDFGR^AK-OH
Peptide H-KI^TDFGR^AK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.VP1 14-22 (HLA-B*07:02)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFmoc-Ile-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Ile-Wang resin is a polystyrene resin which is used in the synthesis of peptides. It has a high loading capacity, and can be cleaved with hydrofluoric acid. The Fmoc-Ile-Wang resin contains 1% DVB as an acidic scavenger to prevent the formation of side products. The resin is also available in 100-200 mesh size.Pureza:Min. 95%H-NWVYSHDGVSLHELLAAELTK^-OH
Peptide H-NWVYSHDGVSLHELLAAELTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
L-Pen(p-Me-Bzl)
L-Penicillamine (L-Pen) is a metabolite of penicillin and is the toxic from of penicillin’s two enantiomers L-Pen and D-Pen. While D-Pen is a clinically useful metal chelator protein with its ability to help treat Wilson’s diseases and possible Alzheimer’s disease, L-Pen can result in neuritis and marrow damage. It is important therefore that methods are developed, particularly in the pharmaceutical industry, to identify and eliminate the presence of L-Pen. One such method is using a chiral molecular imprinting technique.Fórmula:C13H19NO2SPureza:Min. 95%Peso molecular:253.2 g/molEGFR-derived peptide
Peptide EGFR-derived peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C69H114N18O24Peso molecular:1,579.78 g/molAc-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Asp371]-Tyrosinase (369-377), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C42H66N10O16S2Peso molecular:1,031.2 g/mol4-[D10]Leu-Insulin, human
The insulin receptor is a cell surface receptor that binds the hormone insulin, a peptide hormone. It belongs to the class of tyrosine kinase receptors and is activated by the binding of insulin to its extracellular alpha subunit. Insulin causes an increase in glucose uptake in muscle cells and adipocytes by stimulating the activity of several enzymes involved in carbohydrate metabolism. The insulin receptor also has ion channel activity and can activate potassium channels. Insulin receptors are found on many different cell types, including liver cells, fat cells, and brain cells. The protein is composed of two alpha subunits that form a disulfide bond to create a functional dimer. Insulin receptors have been used as research tools for studying protein interactions, ligands, and pharmacology.END>>
Fórmula:C257H343D40N65O77S6Pureza:Min. 95%Peso molecular:5,847.8 g/molHuman PTH (7-34) protein, Unconjugated
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:3.38 g/molH-FEIFPK^-OH
Peptide H-FEIFPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PHSRN-NH2
Peptide Ac-PHSRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-L-Glutamic Acid bis-Propargyl Amide
Boc-L-Glutamic Acid bis-Propargyl Amide is a building block for Click Chemistry. It is a white solid that is soluble in DMF, DMSO and other organic solvents. This product can be used as a reagent for peptide synthesis and as an intermediate for the synthesis of amino acids. Boc-L-Glutamic Acid bis-Propargyl Amide reacts with dimethylaminoethanol to form the corresponding amide. It has been shown that this product can be used in click chemistry reactions to form amides and ureas.Fórmula:C16H23N3O4Pureza:Min. 95%Peso molecular:321.3 g/molH-R^PQQPYPQPQPQY-OH
Peptide H-R^PQQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 47 (AFVFPTKDVALRHVV)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,699 g/molH-DI^YETDYYR^-OH
Peptide H-DI^YETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,778 g/molH-GFFADYEIPNLQK^-OH
Peptide H-GFFADYEIPNLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-95/aa377 - 391
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,906.3 g/mol
![Des-n-Octanoyl-[Ser3]-Ghrelin (Human, 1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPGH-3646-PI.webp&w=3840&q=75)
![Phe4,9 [Ring D5]-Hepcidin (Rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3780-PI.webp&w=3840&q=75)
![DOTA-Glu-[Cyclo(Arg-Gly-Asp-D-Phe-Lys)]2](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPCI-3903-PI.webp&w=3840&q=75)
![[Asp371]-Tyrosinase (369-377), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50380.webp&w=3840&q=75)
![4-[D10]Leu-Insulin, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPLP-3404-V.webp&w=3840&q=75)
