Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29635 productos de "Péptidos"
H-LFDSDPITVTVPVEVSR^-OH
Peptide H-LFDSDPITVTVPVEVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 45
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,697.9 g/molSIVmac239 - 71
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,714 g/molSIVmac239 - 9
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,697.9 g/molH-ASLEDLGWADWVLSPR^-OH
Peptide H-ASLEDLGWADWVLSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGASVLGL^-OH
Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALGISPFHEHAEVVFTANDSGPR^-OH
Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 82
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,569.9 g/molH-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH
Peptide H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYQAVTTTL-OH
Peptide H-KYQAVTTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVAVSQVAR^-OH
Peptide H-SVAVSQVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peptide M trifluoroacetate
Please enquire for more information about Peptide M trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Fórmula:C81H141N21O31•(C2HF3O2)xPureza:Min. 95 Area-%Forma y color:PowderFmoc-Thr(tBu)-Thr(Psi(Me,Me)pro)-OH
CAS:Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is a versatile building block that can be used as a starting material for the synthesis of a wide range of compounds. It is often used as an intermediate in organic chemistry reactions and can be converted to a variety of other compounds with different functional groups. This compound has been shown to be useful in the production of pharmaceuticals and research chemicals. Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is also important for generating high-quality chemical products, such as speciality chemicals and reagents that are difficult to synthesize. The CAS number for this compound is 1676104-73-6.Fórmula:C30H38N2O7Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:538.63 g/mol(Des-Glu22)-Amyloid β-Protein (1-40) trifluoroacetate
CAS:The Aβ E22delta mutant (Osaka mutation) is more resistant to degradation by two major Aβ-degrading enzymes, neprilysin and insulin-degrading enzyme. It also shows unusual aggregation properties with enhanced oligomerization but no fibrilization.
Fórmula:C189H288N52O55SPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:4,200.69 g/molFmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH is a reagent used in the synthesis of complex compounds. It is also a useful scaffold for the synthesis of speciality chemicals and versatile building blocks. This compound is an intermediate that can be used in the preparation of fine chemicals and pharmaceuticals. Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH has a CAS number of 139573-78-7 and can be purchased as a high quality chemical.Fórmula:C53H83NO8SPureza:Min. 95 Area-%Forma y color:Slightly Yellow PowderPeso molecular:894.29 g/molH-AVLGTSNFK^-OH
Peptide H-AVLGTSNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,093.3 g/molCyclin-A2 Human Recombinant
Please enquire for more information about Cyclin-A2 Human Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:>90% By Sds-Page.CMVpp65 - 31 (LNIPSINVHHYPSAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,632.8 g/molH-VNVEDAGGETLGR^-OH
Peptide H-VNVEDAGGETLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IALGGLLFPASNLR^-OH
Peptide H-IALGGLLFPASNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VTSAPDTRPAPGSTAPPAHG-OH
Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SPALHFLGGGSC-NH2
Peptide H-SPALHFLGGGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESNF^NTQATNR^-OH
Peptide H-FESNF^NTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-71/aa281 - 295
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,771 g/molH-RKKRRQRRRCSTRIRRQL-NH2
Peptide H-RKKRRQRRRCSTRIRRQL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-Glu(Edans)-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dabcyl)-Arg-OH
H-Arg-Glu(Edans)-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dabcyl)-Arg-OH is a peptide that is a substrate for the enzyme beta secretase. It has been observed to inhibit γ secretase activity in cell culture. This product can be used as an enzyme substrate or biochemicals, such as memapsin.Fórmula:C91H129N25O25SPureza:Min. 95%Peso molecular:2,005.26 g/molH-ELINNELSHFLEEIK^-OH
Peptide H-ELINNELSHFLEEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAVEVLK^-OH
Peptide H-NAVEVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-SEEEDPAPSRKIHFSTAPIQVFST-NH2
Peptide Ac-SEEEDPAPSRKIHFSTAPIQVFST-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSPDDSAGASALL^^R-OH
Peptide H-FSPDDSAGASALL^^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH
Peptide H-GHPEPLDLHLGMFLPTLLHQATEEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peso molecular:3,247.64 g/molH-QYFFET^K-OH
Peptide H-QYFFET^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLFGYPVYV^-OH
Peptide H-LLFGYPVYV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYALSQGTTIR^-OH
Peptide H-FYALSQGTTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Tyr-Val-Met-Gly-His-Phe-Arg-D-Trp-Asp-Arg-Phe-Gly-OH
H-Tyr-Val-Met-Gly-His-Phe-Arg-D-Trp-Asp-Arg-Phe-Gly-OH is a peptide that has been shown to bind to the melanocortin receptor. It is a selective agonist that binds to the melanocortin 2 receptor, but not the melanocortin 1 receptor. This peptide has no effect on body weight in mice, but it does cause an increase in food intake and fat mass. H-Tyr-Val-Met gly His Phe Arg D Trp Asp Arg Phe Gly OH also has been shown to be an effective analgesic for chronic pain in rats.Fórmula:C74H99N21O16SPureza:Min. 95%Peso molecular:1,570.81 g/molVal-Ile-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C20H31N3O4Peso molecular:377.48 g/molH-QIWLSSPSSGPK^-OH
Peptide H-QIWLSSPSSGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QGVAEAAGK^-OH
Peptide H-QGVAEAAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Suc-Ala-Ala-Pro-Abu-pNA
Suc-Ala-Ala-Pro-Abu-pNA is a peptide that has been shown to inhibit the activity of elastase, an enzyme that breaks down proteins in tissues. It is used as a substrate for enzyme assays and as a tool for studying elastase. This peptide can be used to study the structure and function of elastases, which are necessary for the breakdown of proteins in tissues.
Fórmula:C25H34N6O9Pureza:Min. 95%Peso molecular:562.58 g/molH-GGLPLEEVTVAEVLAAR^-OH
Peptide H-GGLPLEEVTVAEVLAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Head activator (7-11) acetate
CAS:Please enquire for more information about Head activator (7-11) acetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C32H54N6O6•(C2H4O2)xPureza:Min. 95%Peso molecular:618.81 g/molH-EDSQCVIGLYQPPLQVY-NH2
Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVYTILPDGEVVGDSAK^-OH
Peptide H-LLVYTILPDGEVVGDSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSVVVPYEPPEAGSEYTTIHYK^-OH
Peptide H-HSVVVPYEPPEAGSEYTTIHYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-DRVYIHPF-OH
Angiotensin II plays an essential role in the maintenance of blood pressure and blood volume. It is a peptide hormone that causes vasoconstriction, a sensation of thirst, and stimulation of the adrenal cortex and aldosterone.
Derived from the cleavage of angiotensin I by the angiotensin converting enzyme, angiotensin II is involved in the renin-angiotensin system (RAS).
Angiotensin II is the subject of much scientific research and is already the target of many anti-hypertensive drugs (ACE inhibitors, ARBs or AT1 receptor antagonists).H-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Asn670,Sta671,Va672)-Amyloid β/A4 Protein Precursor770 (662-675) ammonium salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H118N16O27Peso molecular:1,651.83 g/molH-LVLLNAIYLSAK^-OH
Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GNLLINIR^-OH
Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biotin-Arg-Gly-Asp-OH TFA salt
Biotinylated RGD peptideFórmula:C22H34N8O7S(freebase)Pureza:Min. 95%Peso molecular:554.63 g/molAc-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,356.5 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Puma2A peptide
PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.Candidalysin
CAS:Candidalysin is a research tool that is used to activate, bind, or block the activity of receptors. Candidalysin is a ligand that binds to specific receptors on cells and activates them. It can be used as a receptor-specific inhibitor or activator.
Fórmula:C153H266N38O38S2Pureza:Min. 95%Peso molecular:3,310.1 g/molRanatensin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H85N16O13SPeso molecular:1,281.5 g/molH-FASFEAQGALANIAVDK^-OH
Peptide H-FASFEAQGALANIAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-DKFNHEAEDLFYQ-NH2
Peptide Ac-DKFNHEAEDLFYQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVTKYTSSK-NH2
Peptide H-AVTKYTSSK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGFTGGDILR^-OH
Peptide H-GPGFTGGDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLGRKIQI-NH2
Peptide Ac-SLGRKIQI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Suc-KGFLGK-NH2
Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CSEGEKARKNIVLARRRP-NH2
Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSDLIVLGLPWK^-OH
Peptide H-TSDLIVLGLPWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTFAQLSELHCDK^-OH
Peptide H-GTFAQLSELHCDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALVLIAFAQYLQQCPFEDHVK^-OH
Peptide H-ALVLIAFAQYLQQCPFEDHVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CMQNPYSRHSSMPRPDY-OH
Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KITDFGRAK^-OH
Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Des-acetyl)-α-MSH
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C75H107N21O18S1Peso molecular:1,622.88 g/molAc-CDGPTEIYKLTRKEAQE-OH
Peptide Ac-CDGPTEIYKLTRKEAQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Z-Gly-Ala-Met-AMC
CAS:Z-Gly-Ala-Met-AMC is a protease inhibitor that has been shown to inhibit the amyloidogenic processing of β-amyloid and reduce the formation of amyloid plaques in vivo. It also inhibits the degradation of normal proteins by proteases, which leads to cell death. Z-Gly-Ala-Met-AMC is used as a marker for identifying and quantifying proteolytic activity in cells with high levels of proteolytic activity. The drug has been shown to be effective in assays using cell populations and homogenous assays.
Fórmula:C28H32N4O7SPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:568.64 g/molAc-ASRMEEVD-OH
Peptide Ac-ASRMEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SDF-1β (human) trifluoroacetate salt
CAS:Please enquire for more information about SDF-1beta (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C382H620N114O97S5Pureza:Min. 95%Peso molecular:8,522.05 g/molPKC β pseudosubstrate
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C177H294N62O38S3Peso molecular:3,994.84 g/molAc-SVFAQ-OH
Peptide Ac-SVFAQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FMRF-like neuropeptide flp-9-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H66N12O8Peso molecular:879 g/molH-VVNVSSIMSVR^-OH
Peptide H-VVNVSSIMSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VPGVG^-OH
Peptide H-VPGVG^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2
Ac-Tyr-Val-Nle-Gly-His-D-Phe-Arg-Trp-Asp-Arg-Phe-Gly-NH2 is a peptide that is a melanocortin receptor agonist. It has been shown to have biochemically active properties and can be used as a research tool in the study of peptides and their receptors.Pureza:Min. 95%H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Trp(Boc)-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for the synthesis of peptides. It is used as building blocks in the synthesis of peptide derivatives, such as amines, alcohols, thiols, and other amino acids. This resin has been shown to be stable in aqueous or organic solvents.
Pureza:Min. 95%Ac-LSLR-AMC
Peptide Ac-LSLR-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPGF^SP-OH
Peptide H-RPPGF^SP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2
CAS:Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me-Abz)-NH2 is a peptide that has shown to be a potent inhibitor of MMP-1. It may also inhibit other proteases such as collagenase, stromelysin and cathepsins. Dnp-Pro-Cha-Abu-Cys(Me)-His-Ala-Lys(N-Me)-NH2 has a fluorogenic property, which makes it useful for high throughput screening of protease inhibitors. This peptide can be used in the development of new drugs for the treatment and prevention of various diseases such as cancer, cardiovascular disease and arthritis.Fórmula:C51H72N14O12SPureza:Min. 95%Peso molecular:1,105.29 g/molH-TGISPLALIK^-OH
Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(Des-Asp1)-Angiotensin I
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C58H84N16O11Peso molecular:1,181.42 g/molAc-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2
Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIYKRWII^-OH
Peptide H-EIYKRWII^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEGPGEQETK^-OH
Peptide H-LEGPGEQETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cathelin-related
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C197H338N56O50Peso molecular:4,291.1 g/molH-DRVYI^HPFH-OH
Peptide H-DRVYI^HPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIASNGVK^LV-OH
Peptide H-FIASNGVK^LV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KMLEILFEL^-OH
Peptide H-KMLEILFEL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITVVDALHEIPVK^-OH
Peptide H-ITVVDALHEIPVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KLTWQELYQLK^YKGI-NH2
Peptide Ac-KLTWQELYQLK^YKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Mal-VYLKTNVFL-OH
Peptide Mal-VYLKTNVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LISEIDLLR^-OH
Peptide H-LISEIDLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
