
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29609 productos de "Péptidos"
Ac-KKVAVVRTPPKSPSSAKSR-NH2
Peptide Ac-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.gp100 (457-466)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C47H85N13O15Peso molecular:1,072.28 g/molH-GDMGDVQHFADDVIAQR^-OH
Peptide H-GDMGDVQHFADDVIAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFEELVR^-OH
Peptide H-LFEELVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQSKPER^-OH
Peptide H-AQSKPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-S^LSLSPG-OH
Peptide H-S^LSLSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 91
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,562.7 g/molZ-LLY-NH2
Peptide Z-LLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTVEDPVTVEYITR^-OH
Peptide H-LTVEDPVTVEYITR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5TAMRA-SGGDDDWTHLS-NH2
Peptide 5TAMRA-SGGDDDWTHLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QITIPSQEQEHSQK^-OH
Peptide H-QITIPSQEQEHSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CQSSMDHQAPLATVT-NH2
Peptide Ac-CQSSMDHQAPLATVT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLDLLEGLTGQK^-OH
Peptide H-LLDLLEGLTGQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 170
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,897.4 g/molNeuropeptide K
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C175H284N52O52SPeso molecular:3,980.4 g/molFALL-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C217H354N62O55Peso molecular:24.7 g/molH-DINAYNCEEPTEK^-OH
Peptide H-DINAYNCEEPTEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VEHSDLSFSK^-OH
Peptide H-VEHSDLSFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 113
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,606.9 g/molH-STDTAYMELSSLR^-OH
Peptide H-STDTAYMELSSLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LVLRLRGG-OH
Peptide LCBiot-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-YEVHHQKLVF-OH
Peptide Ac-YEVHHQKLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-IKPDVAVSC-NH2
Peptide Ac-IKPDVAVSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Gly-Gly-Gly-Gly-Arg-Gly-Asp-Tyr
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C29H43N11O12Peso molecular:737.72 g/molAc-LDDRHDDGLDDMKDEEY-NH2
Peptide Ac-LDDRHDDGLDDMKDEEY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HHGPTITAK^-OH
Peptide H-HHGPTITAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ala-Ile-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C14H27N3O4Peso molecular:301.38 g/molHIV - 1 MN ENV - 141
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,782.1 g/molH-TFRRRN-NH2
Peptide H-TFRRRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVFDFSQR^-OH
Peptide H-EVFDFSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGVYELLLK^-OH
Peptide H-LGVYELLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYEPLEDPGVK^-OH
Peptide H-SYEPLEDPGVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 52 (VCSMENTRATKMQVI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,711.1 g/molH-VSSASDYNSSELK^-OH
Peptide H-VSSASDYNSSELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 80
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,748 g/molH-VAIDAGYR^-OH
Peptide H-VAIDAGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Eα (52–68)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C73H118N20O25Peso molecular:1,675.87 g/molH-KI^TDFGR^AK-OH
Peptide H-KI^TDFGR^AK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SP^YQLVLQHSR^-OH
Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIPGGIYNADLNDEWVQR^-OH
Peptide H-IIPGGIYNADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYPSDIAVEWESNGQPENNYK-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISQAVHAAHAEINEAGR-cysteamide
Peptide H-ISQAVHAAHAEINEAGR-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIQMTQSPSSLSASVGDRVTITCR-NH2
Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Mastoparan-T
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H129N19O15Peso molecular:1,512.9 g/molHXB2 gag NO-38/aa149 - 163
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,740 g/molCyc-DHECHYRIKPTFRRLKWKYKGKFWCPS-OH
Peptide Cyc-DHECHYRIKPTFRRLKWKYKGKFWCPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ENQLEVLEVSWLHGLK^-OH
Peptide H-ENQLEVLEVSWLHGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-RWKFGGFKWR-OH
Peptide Myr-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-EADPTGHSY-OH
Peptide Biot-EADPTGHSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.EGFRvIII peptide (PEPvIII)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C70H111N19O24SPeso molecular:1,634.81 g/molR5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molAc-IAMVD-OH
Peptide Ac-IAMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^V^GGLV^ALR^-OH
Peptide H-V^V^GGLV^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAGQDGSVVQFK^-OH
Peptide H-VAGQDGSVVQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYEAFSK^-OH
Peptide H-FYEAFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPLTNAIK^-OH
Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abz-GIEPFSDPMPEQ-EDDnp
Peptide Abz-GIEPFSDPMPEQ-EDDnp is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKYDLSIRGFNKETA-NH2
Peptide Ac-CKYDLSIRGFNKETA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLGPVGFMK^-OH
Peptide H-SLGPVGFMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELISNASDALDK^-OH
Peptide H-ELISNASDALDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Peptide T
Peptide Peptide T is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C35H55N9O16Peso molecular:857.8 g/molAc-QKDGNDFKFNYQGDEC-NH2
Peptide Ac-QKDGNDFKFNYQGDEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Premelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolAc-LWWPD-OH
Peptide Ac-LWWPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RR^-OH
Peptide H-RR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FEIFPK^-OH
Peptide H-FEIFPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NWVYSHDGVSLHELLAAELTK^-OH
Peptide H-NWVYSHDGVSLHELLAAELTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
EGFR-derived peptide
Peptide EGFR-derived peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C69H114N18O24Peso molecular:1,579.78 g/molFluor-AEEEIYGEFEAKKKK-OH
Peptide Fluor-AEEEIYGEFEAKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-106
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,778 g/molH-LLIYGATNLADGVPSR^-OH
Peptide H-LLIYGATNLADGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CLAVEEVSL^-OH
Peptide H-CLAVEEVSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Histatin 5
CAS:Peptide Histatin 5 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C133H195N51O33Peso molecular:3,036.36 g/molH-QRPIF^IITEYMANGCLLNYLR-OH
Peptide H-QRPIF^IITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIFSFYLNR^-OH
Peptide H-NIFSFYLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^PQQPYPQPQPQY-OH
Peptide H-R^PQQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGGVTFTWVEK^-OH
Peptide H-EGGVTFTWVEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CSYWKPRYLGAKRF-OH
Peptide Ac-CSYWKPRYLGAKRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFFADYEIPNLQK^-OH
Peptide H-GFFADYEIPNLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVY^DGR^EHTV-OH
Peptide H-GVY^DGR^EHTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CRKQPVKEVPQFSEED-NH2
Peptide Ac-CRKQPVKEVPQFSEED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGGPSQIGDALGFAVR^-OH
Peptide H-EGGPSQIGDALGFAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pal-KTTKS-OH
Peptide Pal-KTTKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FVEGLPINDFSR^-OH
Peptide H-FVEGLPINDFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HLA-B*15:01 Human pp65 KMQVIGDQY
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Ac-RGDY-NH2
Peptide Ac-RGDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AR^PALEDLR-OH
Peptide H-AR^PALEDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGEPLVLK^-OH
Peptide H-IGEPLVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.BrAc-TWPKHFDKHTFYSILKLGKH-NH2
Peptide BrAc-TWPKHFDKHTFYSILKLGKH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:2,604.86 g/molH-DI^YETDYYR^-OH
Peptide H-DI^YETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SARS-CoV-2 ORF3a prot_1 A2 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolBiot-YARAAARQARA-OH
Peptide Biot-YARAAARQARA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
