
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29608 productos de "Péptidos"
Gly-Val-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C12H23N3O4Peso molecular:273.33 g/molCMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,680.8 g/molH-TPDVSSAL^DK-OH
Peptide H-TPDVSSAL^DK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-A^VLQ-OH
Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-YGGFLRRQFKVVT-OH
Peptide Ac-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 19
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,785.1 g/molH-VVVQTESGGR^-OH
Peptide H-VVVQTESGGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LNFARKRIKNPEGGLC-NH2
Peptide Ac-LNFARKRIKNPEGGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-HHHHHH-OH
Peptide Ac-HHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Exendin-4
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C184H282N50O60SPeso molecular:4,186.63 g/molEGFRvIII peptide (PEPvIII)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C70H111N19O24SPeso molecular:1,634.81 g/molH-FSGVPDR^-OH
Peptide H-FSGVPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FDGCYCDSLENLADGYK^-OH
Peptide H-FDGCYCDSLENLADGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-RDVYEEDSYVKRSQG-NH2
Peptide Biot-RDVYEEDSYVKRSQG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SNL-NH2
Peptide H-SNL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2
Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.δ Sleep Inducing Peptide
Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C35H48N10O15Peso molecular:848.83 g/molFluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQVSLTCLVK^-OH
Peptide H-NQVSLTCLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NNHTASILDR^-OH
Peptide H-NNHTASILDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GAPVNISSSDLTGR^-OH
Peptide H-GAPVNISSSDLTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 59 (EDVPSGKLFMHVTLG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,629.9 g/molH-YTIAALLSPYSYSTTAVVTNPK^-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 75
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,891 g/molLCBiot-ENPVVHFFKNIVTPR-OH
Peptide LCBiot-ENPVVHFFKNIVTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SGVYKVAYDWQH-NH2
Peptide LCBiot-SGVYKVAYDWQH-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WMDF^-NH2
Peptide H-WMDF^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Peso molecular:606.7 g/molHIV-1 Nef 92-100 (HLA-B*40:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-VTTHPLAK^-OH
Peptide H-VTTHPLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNWYV^DGVEVHNAK^-OH
Peptide H-FNWYV^DGVEVHNAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,685.9 g/molH-IIAPPERK^-OH
Peptide H-IIAPPERK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Tirzepatide sodium
CAS:Cymit Quimica provides this product solely for uses within the scope of any statute or law providing for an immunity, exemption, or exception to patent infringement (“Exempted Uses”), including but not limited to 35 U.S.C. § 271(e)(1) in the United States, the Bolar type exemption in Europe, and any corresponding exception to patent infringement in any other country. It is the sole responsibility of the purchaser or user of this product, and the purchaser or user of this product agrees to engage only in such Exempted Uses, and to comply with all applicable intellectual property laws and/or regulations. The purchaser of this product agrees to indemnify Cymit Quimica against all claims in connection with the performance of the respective commercial agreement (e.g. supply agreement) and possible infringements of intellectual property rights.
Fórmula:C225H348N48O68•xNaPureza:Min. 95 Area-%Forma y color:PowderH-SSALFYQK^-OH
Peptide H-SSALFYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RRRRR-NH2
Peptide H-RRRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-G^^G^^G-OH
Peptide H-G^^G^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELFSYLIEK^-OH
Peptide H-ELFSYLIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RASTIEMPQQAR^-OH
Peptide H-RASTIEMPQQAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTVLTES^AAK^-OH
Peptide H-FTVLTES^AAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGESEQIIVTR^-OH
Peptide H-FGESEQIIVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VDPVNFK^-OH
Peptide H-VDPVNFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Arg-Arg-AMC hydrochloride salt
CAS:H-Arg-Arg-AMC hydrochloride salt is a proteolytic inhibitor that binds to the active site of aminopeptidases and prevents their proteolytic activity. This inhibition leads to increased muscle mass in juveniles, as well as higher concentrations of magnesium ions in sarcoplasmic and myofibrillar proteins. H-Arg-Arg-AMC hydrochloride salt also has an inhibitory effect on ion exchange and chloride transport in muscle cells. The biochemical effects of this drug are due to its ability to inhibit the aminopeptidase enzymes, which play a role in the metabolism of amino acids.Fórmula:C22H33N9O4Pureza:Min. 95%Forma y color:PowderPeso molecular:487.56 g/molIle-Pro-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C17H31N3O4Peso molecular:341.45 g/molCMVpp65 - 33 (HHYPSAAERKHRHLP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,836.1 g/molH-AVLQSGFRKK-OH
Peptide H-AVLQSGFRKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AFVDFLSDEIK^-OH
Peptide H-AFVDFLSDEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IADFGLARLIEDNEYTARQGAK^-OH
Peptide H-IADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVYDFAFR^-OH
Peptide H-EVYDFAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYELPDGQVITIGNER^-OH
Peptide H-SYELPDGQVITIGNER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-RDKVESQVESAPKEC-NH2
Peptide Ac-RDKVESQVESAPKEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Tyr-AMC
CAS:H-Tyr-AMC is a synthetic substrate that is used in the study of serine proteases. It is reversibly bound to Sephadex G-100 and is hydrolyzed by protease enzymes in an acidic environment, generating an AMC chromatographic peak. This product has been shown to inhibit serine protease activity and, when incubated with the enzyme, reduces the hydrolysis of synthetic substrates. Synthetic H-Tyr-AMC can be used to study the inhibition of serine proteases by various inhibitors and their binding sites on the enzyme.Fórmula:C19H18N2O4Pureza:Min. 99 Area-%Forma y color:White PowderPeso molecular:338.36 g/molH-TLLLQIAK^-OH
Peptide H-TLLLQIAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,502.8 g/molSIVmac239 - 81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,655 g/molHIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C73H126N26O18Peso molecular:1,656 g/molH-F^R^-OH
Peptide H-F^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSESGLPSTR^-OH
Peptide H-TSESGLPSTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Protein Kinase C (19-36)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C93H159N35O24Peso molecular:2,151.51 g/molH-NQEQVSPLTLLK^-OH
Peptide H-NQEQVSPLTLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 117
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,718.1 g/molH-EFPFYGDYGSNYLYDN^-OH
Peptide H-EFPFYGDYGSNYLYDN^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2Adamantyl-RF-NH2
Peptide 2Adamantyl-RF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-YARAAARQARA-OH
Peptide Biot-YARAAARQARA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTHFLTQHYDAKPQGR^-OH
Peptide H-YTHFLTQHYDAKPQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyclo(Arg-Ala-Asp-D-Tyr-Lys)
Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is a peptide macrocycle that has been shown to have potent anti-cancer activity. It binds to the receptor for epidermal growth factor (EGF), which is overexpressed in many cancers, and inhibits its function. Cyclo(Arg-Ala-Asp-D-Tyr-Lys) is also able to inhibit the production of nitric oxide by inhibiting the synthesis of arginase. This peptide has also been shown to induce apoptosis in cancer cells by altering the mitochondrial membrane potential and activating caspases 3 and 9.Fórmula:C28H43N9O8Pureza:Min. 95%Peso molecular:633.70 g/molAla-Ile-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C14H27N3O4Peso molecular:301.38 g/molAc-YEVHHQKLVF-OH
Peptide Ac-YEVHHQKLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-H-LRRFSTMPFMFCNINNVCNF-NH2
Peptide Cyc-H-LRRFSTMPFMFCNINNVCNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TMLLQPAGSLGSYSYR^-OH
Peptide H-TMLLQPAGSLGSYSYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APAATVVNVDEVR^-OH
Peptide H-APAATVVNVDEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NNN-NH2
Peptide Ac-NNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NL^VPMVATV-OH
Peptide H-NL^VPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-LKIQNRQAAASY-OH
Peptide Biot-LKIQNRQAAASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTFPTGR^-OH
Peptide H-LTFPTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Myr-FTEIPTI^-OH
Peptide Myr-FTEIPTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Pro-Gly-OH
CAS:Fmoc-Pro-Gly-OH is an antimicrobial agent that binds to bacterial cell walls and prevents the bacteria from assembling. It has a conformation that mimics the structure of thioether antibiotics, which are unilamellar and assembled. Fmoc-Pro-Gly-OH inhibits the pyrophosphate binding site, preventing the synthesis of ATP in bacteria. This drug also has affinity for alkene binders, which may be due to its structural similarity to these compounds.
Fórmula:C22H22N2O5Pureza:Min. 95%Forma y color:PowderPeso molecular:394.42 g/molH-VPQVSTPTLVEVSR^-OH
Peptide H-VPQVSTPTLVEVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GGLNDIFEAQKIEWHED-NH2
Peptide Ac-GGLNDIFEAQKIEWHED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-VHWDFRQWWQPS-OH
Peptide LCBiot-VHWDFRQWWQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 84 (IRETVELRQYDPVAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,760 g/molH-RQIKIWFQNRRMKWKK-bMPAthioester
Peptide H-RQIKIWFQNRRMKWKK-bMPAthioester is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLHGFSFYL^-OH
Peptide H-LLHGFSFYL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDPGLIGPK^-OH
Peptide H-GDPGLIGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Melanostatin DM
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H58N14O6Peso molecular:843 g/molIle-Val-Tyr-Arg-Asp-Gly-Asn-Pro-Tyr-Ala
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C53H78N14O16Peso molecular:1,167.27 g/molSIVmac239 - 67
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,908.3 g/molBim BH3 (52-71) acid
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-IALGGLLFPASNL^R^-OH
Peptide H-IALGGLLFPASNL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIAIIAEGIPEALTR^-OH
Peptide H-TIAIIAEGIPEALTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ELPLYR^-OH
Peptide H-ELPLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GTRIIYDRKFLMECRN-NH2
Peptide Ac-GTRIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQQHYPVSAGYTK^-OH
Peptide H-AQQHYPVSAGYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QVPLRPMTYK-NH2
Peptide Ac-QVPLRPMTYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVSVLTVTHQDWL^NGK-OH
Peptide H-VVSVLTVTHQDWL^NGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 118 (DEDSDNEIHNPAVFT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,702.7 g/molH-FSPDDSAGASALL^R-OH
Peptide H-FSPDDSAGASALL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NQTANLTNQGK^-OH
Peptide H-NQTANLTNQGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
