Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29595 productos de "Péptidos"
Histone peptide fragment
Histone peptide fragment is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C56H93N15O16Peso molecular:1,250.44 g/molH-EVFNATRFASVYAWN-OH
Peptide H-EVFNATRFASVYAWN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C83H113N21O22Peso molecular:1,774.93 g/mol[Trp3, Arg5]-Ghrelin (1-5)
CAS:[Trp3, Arg5]-Ghrelin (1-5) is a Growth-Hormone Secretagogue (GHS) receptor agonist which stimulates growth hormone release . The full lenth 28 amino acid peptide Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.Fórmula:C31H41N9O7Pureza:Min. 95%Peso molecular:651.73 g/molAc-NRRRRWRERQR-NH2
Peptide Ac-NRRRRWRERQR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SARS-CoV epitope peptide
The epitope of SARS-CoV could be used in vaccine design.. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C47H58N10O12Peso molecular:973.04 g/molH-SNTSESF-NH2
Peptide H-SNTSESF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GVYFASTEK-OH TFA salt
Peptide H-GVYFASTEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H66N10O14Peso molecular:1,001.09 g/molSIVmac239 - 27
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,699 g/molH-FSPDDSAGASALLR^-OH
Peptide H-FSPDDSAGASALLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GADGVGK^SA-OH
Peptide H-GADGVGK^SA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LFAYPDTHR^-OH
Peptide H-LFAYPDTHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GKGGKGLGKGGAKR-OH
Peptide H-GKGGKGLGKGGAKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C53H97N21O14Peso molecular:1,270.48 g/molH-LVVVGACGVGK^-OH
Peptide H-LVVVGACGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEYL^QAFTY-OH
Peptide H-EEYL^QAFTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DR^VYIHP-OH
Peptide H-DR^VYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LL-37 ( Human)
CAS:LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production. LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which mayFórmula:C205H340N60O53Pureza:Min. 95%Peso molecular:4,493.3 g/molHXB2 gag NO-85/aa337 - 351
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,565.9 g/molH-AAAASAISVARTLLV^FE-OH
Peptide H-AAAASAISVARTLLV^FE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-RSEIISTAPSSWVVPGP-OH
Peptide 5Fam-RSEIISTAPSSWVVPGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTCACTC-OH
Peptide H-GTCACTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C22H37N7O9S3Peso molecular:657.78 g/molEKSQDGGR
Peptide EKSQDGGR is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C33H55N13O14Peso molecular:875.88 g/mol5Fam-DPASNLGLEDIIRKALMGSFDDK-OH
Peptide 5Fam-DPASNLGLEDIIRKALMGSFDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYDLDPGAGSLEI^-OH
Peptide H-SYDLDPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CYPYDVPDYASLRSL-OH
Peptide H-CYPYDVPDYASLRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C80H114N18O24SPeso molecular:1,761.95 g/molH-VFIEDVSR^-OH
Peptide H-VFIEDVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MART-1 (27-35) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C37H67N9O11Peso molecular:814 g/molHXB2 gag NO-53/aa209 - 223
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,654.9 g/molDYKDDDDK
DYKDDDDK-peptide is a 8 aa length peptide used for the competitive elution of FLAG fusion proteins (with excess of free DYKDDDDK-peptide) under non-denaturing conditions.Fórmula:C41H60N10O20Peso molecular:1,012.99 g/molH-KAL^N-OH
Peptide H-KAL^N-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LVLRLR-OH
Peptide Ac-LVLRLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSAPGSQR^-OH
Peptide H-LSAPGSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Cys(Trt)-OH
CAS:Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.Fórmula:C37H31NO4SPureza:Min. 98.0 Area-%Peso molecular:585.71 g/molBiot-KKSRGDYMTMQIG-NH2
Peptide Biot-KKSRGDYMTMQIG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FVQENYLEY^-OH
Peptide H-FVQENYLEY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Neuropeptide S (Human)
CAS:Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.Fórmula:C93H155N31O28SPureza:Min. 95%Peso molecular:2,187.5 g/molFmoc-Ile-OH
Peptide Fmoc-Ile-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLEVPYVDR^-OH
Peptide H-MLEVPYVDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASSIIDELFQDR^-OH
Peptide H-ASSIIDELFQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MGK^LSKIWDLPLDE-OH
Peptide H-MGK^LSKIWDLPLDE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,778 g/molDabcyl-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Arg-Edans
CAS:TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.Fórmula:C70H104N22O18SPureza:Min. 95%Peso molecular:1,573.81 g/mol2-Furoyl-LIGRLO-amide trifluoroacetate salt
CAS:Potent agonist of proteinase-activated receptor-2 (PAR2)Fórmula:C36H63N11O8Forma y color:PowderPeso molecular:777.96 g/molH-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH
Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 82 (QIFLEVQAIRETVEL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788.1 g/molAc-SLKLMATLFSTYAS-OH
Peptide Ac-SLKLMATLFSTYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 50
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,715 g/molBiot-KRRRALSVASLPGL-OH
Peptide Biot-KRRRALSVASLPGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 95 (GKLEYRHTWDRHDEG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,899 g/molH-VVVGAGDVGK^-OH
Peptide H-VVVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LEEQAQQIR^-OH
Peptide H-LEEQAQQIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPGGAWAAEVISNAR^-OH
Peptide H-GPGGAWAAEVISNAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LSYTQQMEDLK^-OH
Peptide H-LSYTQQMEDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLGPALLLLQK^-OH
Peptide H-SLGPALLLLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Tyr(tBu)-Rink-Amide MBHA Resin
Fmoc-Tyr(tBu)-Rink-Amide MBHA Resin is a solid phase peptide synthesis resin that is used for the production of small scale peptides. This resin has high purity and can be used in the synthesis of proteins, antibodies, and other bioactive molecules. Fmoc-Tyr(tBu)-Rink-Amide MBHA Resin is an ion-exchange resin that can be used to purify peptides by binding to their charged side chains. It is also useful as a research tool for cell biology, receptor pharmacology, and as an inhibitor.Pureza:Min. 95%H-YNWNSFGLRF-NH2
Peptide H-YNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lixisenatide acetate
CAS:Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that is used to treat type 2 diabetes. Lixisenatide has been shown to be safe and effective in patients with renal impairment, hepatic impairment, or congestive heart failure. The pharmacokinetics of lixisenatide have been studied in healthy subjects and patients with chronic renal failure receiving dialysis. Lixisenatide has been shown to have a linear pharmacokinetic profile in both populations and has not been found to accumulate in the plasma after repeated doses. Lixisenatide does not bind tightly to human serum albumin, which may make it more suitable for use in patients with atherosclerotic cardiovascular disease who exhibit hyperlipidemia because it will be less likely to affect lipid profiles.Fórmula:C215H347N61O65S•(C2H4O2)xPureza:Min. 95%Forma y color:PowderAc-SYFTNMFATWSPSKARLHLQ-NH2
Peptide Ac-SYFTNMFATWSPSKARLHLQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.hTRT 674-683 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-ELAVAAAYQSVR^-OH
Peptide H-ELAVAAAYQSVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NISH-pNA
Peptide Ac-NISH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 102 (DSDEELVTTERKTPR)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,775.9 g/molLCBiot-IAGEASRLAHYNKRSTITSR-OH
Peptide LCBiot-IAGEASRLAHYNKRSTITSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TDSRCVIGLYHPPLQVY-NH2
Peptide H-TDSRCVIGLYHPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2
CAS:MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.Fórmula:C55H80N16O16Pureza:Min. 95%Peso molecular:1,221.35 g/molAc-LLM-CHO
Peptide Ac-LLM-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Lys(Boc)-Wang Resin (100-200 mesh) 1% DVB
Fmoc-Lys(Boc)-Wang resin is an acid-labile resin that is used as a solid support for peptide synthesis. It can be cleaved with TFA, HF, and HBr to release the polymeric product.Pureza:Min. 95%6Fam-SHLVEALYL^VCGER^G-NH2
Peptide 6Fam-SHLVEALYL^VCGER^G-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin
Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin is a high purity, ion channel ligand that is used in research as a pharmacological tool. It is an activator of Kv1.3 channels and inhibits the function of Kv1.2 channels. This product can be used for the study of protein interactions and receptor pharmacology. Fmoc-Glu(OtBu)-Rink-Amide MBHA Resin also has been found to inhibit the binding of antibodies to cells and can be used for immunoprecipitation experiments. This product has CAS number 188476-46-4 and is available in 1 g and 5 g sizes.Pureza:Min. 95%Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB
Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.Pureza:Min. 95%L-Seryl-L-tyrosine 7-amido-4-methylcoumarin
CAS:L-Seryl-L-tyrosine 7-amido-4-methylcoumarin is a fine chemical that is used as a versatile building block in the synthesis of more complex compounds. It is a reagent and speciality chemical that can be used in research, detection, and analytical chemistry. L-Seryl-L-tyrosine 7-amido-4-methylcoumarin has been shown to be an excellent reaction component with high quality and purity. This product can also be used as a scaffold for the preparation of new compounds with desired properties.Fórmula:C22H23N3O6Forma y color:PowderPeso molecular:425.43 g/molβ-MSH (monkey)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C98H138N28O29SPeso molecular:2,204.41 g/molLCBiot-TSYQVYSK-OH
Peptide LCBiot-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LTVVILEAK^-OH
Peptide H-LTVVILEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAIYEEFLR^-OH
Peptide H-VAIYEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRALASL-NH2
Peptide H-FRALASL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Leu-Enkephalin
Peptide Leu-Enkephalin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C28H38N6O6Peso molecular:554.65 g/molH-EIGELYLPK^-OH
Peptide H-EIGELYLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TLNATGEEIIQQSSK^-OH
Peptide H-TLNATGEEIIQQSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-STEYGEGYACDTDLR^-OH
Peptide H-STEYGEGYACDTDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Gly-Pro-Arg-Pro-OH
CAS:Producto controladoH-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).Fórmula:C18H31N7O5Pureza:Min. 95%Peso molecular:425.48 g/molH-SGAMSP^MSWNSDASTSEAS-OH
Peptide H-SGAMSP^MSWNSDASTSEAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIINTLQK^-OH
Peptide H-GIINTLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 42 (GLAWTRQQNQWKEPD)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,857 g/molH-DSGSPNPAR^-OH
Peptide H-DSGSPNPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPASPETHLDMLR^-OH
Peptide H-LPASPETHLDMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPILTIITLEDSSGNLLGR^-OH
Peptide H-RPILTIITLEDSSGNLLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KQPADGNPDPNANPNVDPN-NH2
Peptide LCBiot-KQPADGNPDPNANPNVDPN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVSLGAGAK^-OH
Peptide H-TVSLGAGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGVNGF^G^R-OH
Peptide H-VGVNGF^G^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-PVVAESPKKP-OH
Peptide LCBiot-PVVAESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVGANPEQLTR^-OH
Peptide H-AVGANPEQLTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVTAVASALSSR^-OH
Peptide H-MVTAVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DTEEEDFHVDQVTTVK^-OH
Peptide H-DTEEEDFHVDQVTTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^PPGFSPF-OH
Peptide H-R^PPGFSPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYFQNCPRG-NH2
Peptide H-SYFQNCPRG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QVQLQQPGAELVKPGASVK^-OH
Peptide H-QVQLQQPGAELVKPGASVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Linaclotide
CAS:Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.Fórmula:C59H79N15O21S6Pureza:Min. 95%Peso molecular:1,526.76 g/molH-TISVIPGLK^-OH
Peptide H-TISVIPGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFAPNLLLDR^-OH
Peptide H-LLFAPNLLLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![[Trp3, Arg5]-Ghrelin (1-5)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPGH-3902-PI.webp&w=3840&q=75)
