
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29595 productos de "Péptidos"
Chorionic Gonadotropin-β (109-145) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C167H264N46O58S1Peso molecular:3,876.27 g/molProinsulin C-peptide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C129H211N35O48Peso molecular:3,020.26 g/molH-GLEWVGWINTYTGEPTYAADFK^-OH
Peptide H-GLEWVGWINTYTGEPTYAADFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLVVYPWTQR^^-OH
Peptide H-LLVVYPWTQR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
KRAS (5-14) WT
Peptide H-KLVVVGAGGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SEVAHR^-OH
Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVTLISFGAFVAK^-OH
Peptide H-IVTLISFGAFVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-PKTPKKAKKL-OH
Peptide Biot-PKTPKKAKKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASFHIPQVQVR^-OH
Peptide H-ASFHIPQVQVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-LVLRLRGG-OH
Peptide LCBiot-LVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLIYDASNLETGVPSR^-OH
Peptide H-LLIYDASNLETGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVDLSTFYQNR^-OH
Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.FALL-39
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C217H354N62O55Peso molecular:24.7 g/molLCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide LCBiot-GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 60 (SGKLFMHVTLGSDVE)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,619.9 g/molZ-LLY-NH2
Peptide Z-LLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Lys27(Azido), Exendin-4
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C189H293N52O61SPeso molecular:4,311.96 g/molH-GDMGDVQHFADDVIAQR^-OH
Peptide H-GDMGDVQHFADDVIAQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-5-(diaminomethylideneamino)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]penta noyl]amino]-3-methylbutanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3-methylbutanoyl]amino]-3-(1H-imidazol-5-yl)propan
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C49H70N14O11Peso molecular:1,031.2 g/molH-LGVYELLLK^-OH
Peptide H-LGVYELLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HGESAWNLENR^-OH
Peptide H-HGESAWNLENR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
MBP (63-81)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,645.1 g/molH-NAIIK^-OH
Peptide H-NAIIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EEEEE-OH
Peptide Ac-EEEEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGYYGYTG^AFR^-OH
Peptide H-EGYYGYTG^AFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGPR^NQDWL-OH
Peptide H-EGPR^NQDWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STSGGTAALGCL^VK-OH
Peptide H-STSGGTAALGCL^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSPG-NH2
Peptide H-SLSLSPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSAQQVQGVHAR^-OH
Peptide H-VSAQQVQGVHAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANIKLSVQMKLFKRHLKWKIIVKLNDGRELSLD-NH2
Peptide H-ANIKLSVQMKLFKRHLKWKIIVKLNDGRELSLD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGKGGAKRHRKVLRDNIQGIT-NTPEGBiot
Peptide H-LGKGGAKRHRKVLRDNIQGIT-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CSHRKSLPKAD-OH
Peptide Ac-CSHRKSLPKAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pal-AAAAGGGERGD-OH
Peptide Pal-AAAAGGGERGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GL^PAPI^EK-OH
Peptide H-GL^PAPI^EK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Max-1
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C107H201N29O21Peso molecular:2,230 g/molH-KALYDYAPI-OH
Peptide H-KALYDYAPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fórmula:C51H74N10O13Forma y color:PowderPeso molecular:1,053.21 g/molH-GSTLGLDIETATR^-OH
H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-RVYI^HP-OH
Peptide H-RVYI^HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cys(BDP630/650)-Galanin (1-30) Human
Galanin (1-30) (human) is an endogenous neuropeptide with endocrine, metabolic and behavioural effects. Galanin has a role in intestinal smooth muscle contraction, insulin and somatostatin release, and synaptic neurotransmission.Galanin is widely distributed in the central nervous, peripheral, and endocrine systems. Galanin's overarching function is as an inhibitory, hyper-polarizing neuromodulator for classical neurotransmitters like acetylcholine and serotonin. Galanin interacts with 3 receptor subtypes, GalR1-3 G protein-coupled receptors inserted into the plasma membrane. GalR1 is believed to activate a Gβγ pathway to regulate MAPK activation. GalR2 can also activate the MAPK pathway, but unlike GalR1, there is detectable inositol phosphate production. GalR3 is associated with the Galphai/o pathway. Activation of the receptor leads to a cellular influx of K+. Each receptor has been associated with neurological diseases such as GalR3 and epilepsy.Galanin protects against various physiological insults in vitro, including excitotoxicity and β-amyloid toxicity. Changes in galanin have been widely studied in Alzheimer's disease, and galaninergic neurons are spared in late-stage Alzheimer's relative to non-galaninergic neurones.Galanin (1-30) has been used as an agonist for the GalR2 receptor in vitro for calcium mobilisation assays to understand the role Galanin/GalR2 play in multiple sclerosis.Galanin (1-30) is provided with an N-terminal borondipyrromethene (BDP) fluorophore (630/650), excitation/ emission 628/642nm. It offers a relatively long fluorescence time and high quantum yield as a fluorophore. BDP630/650 is highly suited to in vivo cell imaging, co-localisation imaging and dynamic organelle fusion. Galanin (1-30) is provided with an N-terminal cysteine residue that allows site-specific conjugation.
Peso molecular:3,830.8 g/molAngiotensin II, ala(8)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C44H67N13O12Peso molecular:970.1 g/molAc-SLRRYP-NH2
Peptide Ac-SLRRYP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPGSAAPYLK^-OH
Peptide H-DPGSAAPYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 94
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,519.8 g/molH-TGLQLSQDPTGR^-OH
Peptide H-TGLQLSQDPTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVVEVDESGTR^-OH
Peptide H-AVVEVDESGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KRRR-NH2
Peptide Ac-KRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRHDS-NH2
Peptide H-FRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 96 (YRHTWDRHDEGAAQG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,798.9 g/molH-YAFGYPS-NH2
Peptide H-YAFGYPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DI^TPTLTLYVGK^-OH
Peptide H-DI^TPTLTLYVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FNLAGNHEQEFLR^-OH
Peptide H-FNLAGNHEQEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVLDSDGSFFLYSK-OH
Peptide H-TTPPVLDSDGSFFLYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ile-Pro-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C17H31N3O4Peso molecular:341.45 g/molMyr-FTEIPTI-OH
Peptide Myr-FTEIPTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-SFIEDLLFNKVTLADAGF-OH
Peptide LCBiot-SFIEDLLFNKVTLADAGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EILDLAAATER^-OH
Peptide H-EILDLAAATER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-YLGR-OH
Peptide Ac-YLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GGGGG-Dabcyl
Peptide H-GGGGG-Dabcyl is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Bivalirudin (1-11)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLCBiot-SMFVYGGCQGNNNNFQSKANC-NH2
Peptide LCBiot-SMFVYGGCQGNNNNFQSKANC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITTQQWLIK^-OH
Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 69
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,794.2 g/molH-LSITGTYDLK-OH
Peptide H-LSITGTYDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C50H83N11O17Forma y color:PowderPeso molecular:1,110.26 g/molH-RLVDDFLL^V-OH
Peptide H-RLVDDFLL^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTLLALHR^-OH
Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLQSGFRKK-OH
Peptide H-AVLQSGFRKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RLRPGGKKK^-OH
Peptide H-RLRPGGKKK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GDLIAEVETDK^ATV-OH
Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTPPVL^DSDGSF^FLYSR-OH
Peptide H-TTPPVL^DSDGSF^FLYSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EDALNETR^-OH
Peptide H-EDALNETR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PB-PKKKRKV
Peptide PB-PKKKRKV is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQVLVFLGQSEGLR^-OH
Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 108 (ASTSAGRKRKSASSA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,464.6 g/molH-APAMFNIR^-OH
Peptide H-APAMFNIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITLEVESSDTIDNVK^-OH
Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HER-2/neu 689-697 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FRKKWNKWALSR-NH2
Peptide H-FRKKWNKWALSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLELTSDNDR^-OH
Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFVDFLSDEIK^-OH
Peptide H-AFVDFLSDEIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^EQAPNLVY-OH
Peptide H-R^EQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLVIQGDER^-OH
Peptide H-YLVIQGDER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 64 (DLTMTRNPQPFMRPH)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,841.2 g/molH-YLYEIAR^-OH
Peptide H-YLYEIAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VQFQSGGANSPALYLLDGLR^-OH
Peptide H-VQFQSGGANSPALYLLDGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLPAVPSL^-OH
Peptide H-ALLPAVPSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-EDIIRNIARHLAQVGDSMDR-OH
Peptide 5FAM-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YQGFIFDIVTK^-OH
Peptide H-YQGFIFDIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALSTGEKGFGYK^-OH
Peptide H-ALSTGEKGFGYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CVSGWRLFKKIS-NH2
Peptide Ac-CVSGWRLFKKIS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQRY-NH2
H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFórmula:C194H295N55O57Peso molecular:4,309.81 g/molH-RCGPDCFDNYGRYKYCF-NH2
Peptide H-RCGPDCFDNYGRYKYCF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SEFVVPDLELPSWLTTGNYR^-OH
Peptide H-SEFVVPDLELPSWLTTGNYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YNGIITDTI^K-OH
Peptide H-YNGIITDTI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 18
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,625.8 g/molH-EVYDFAFR^-OH
Peptide H-EVYDFAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GEEIYGEFD-NH2
Peptide Ac-GEEIYGEFD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Trp-Asn-Phe-Ala-Gly-Ile-Glu-Ala-Ala-Ala-Ser-Ala-Il
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C68H100N18O21Peso molecular:1,505.63 g/molH-FLRGRAYGL^-OH
Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LGR-OH
Peptide Boc-LGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LESLLEEK^-OH
Peptide H-LESLLEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
