Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29641 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
FMRF
CAS:FMRF is a peptide consisting of 4 amino acid residues.Fórmula:C29H41N7O5SPureza:98%Forma y color:SolidPeso molecular:599.74β-Amyloid 15-21
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease. This fragment is involved in beta sheet formation.Fórmula:C43H65N9O9Pureza:98%Forma y color:SolidPeso molecular:852.03Pezadeftide
CAS:Pezadeftide, a potent antifungal peptide, readily penetrates fungal cells, eliciting an immediate mitochondrial response that leads to hyperpolarization of thePureza:98%Forma y color:SolidAllatostatin IV
CAS:Allatostatin IV, an insect octapeptide, regulates juvenile hormone synthesis.Fórmula:C45H68N12O12Pureza:98%Forma y color:SolidPeso molecular:969.09Tetrapeptide-3
CAS:Tetrapeptide-3 is a bioactive chemical.Fórmula:C20H37N9O4Pureza:98%Forma y color:SolidPeso molecular:467.57AtPep3 TFA (902781-14-0 free base)
AtPep3 TFA is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.Fórmula:C104H179N36F3O34Pureza:98%Forma y color:SolidPeso molecular:2534.75Urocortin III, mouse TFA (357952-10-4 free base)
Urocortin III, a mouse peptide, activates CRF-R2, affecting stress response and social behavior in the medial amygdala.Fórmula:C188H313N52F3O54S2Pureza:98%Forma y color:SolidPeso molecular:4286.99Adrenomedullin (AM) (1-52), human TFA
Adrenomedullin (AM) (1-52), human (TFA) is an NH2 terminal truncated adrenomedullin analogue,affects cell proliferation and angiogenesis in cancer.Fórmula:C266H407F3N80O79S3Pureza:98%Forma y color:SolidPeso molecular:6142.76Acv tripeptide
CAS:Acv tripeptide is a crucial precursor in penicillin and cephalosporin biosyntheses.Fórmula:C14H25N3O6SPureza:98%Forma y color:SolidPeso molecular:363.43A2-Binding peptide
CAS:A2-Binding peptide has involved in the assembly of MHC Class I molecules.Fórmula:C61H106N14O15Pureza:98%Forma y color:SolidPeso molecular:1275.602Solnatide
CAS:Solnatide is a synthetic peptide mimicking the lectin-like domain of TNF.Fórmula:C82H119N23O27S2Pureza:98%Forma y color:SolidPeso molecular:1923.09[Sar9,Met(O2)11]-Substance P TFA(110880-55-2,free)
Selective NK1 receptor agonist; increases MAP, HR, face washing, sniffing; unique in causing grooming.Fórmula:C66H101N18F3O17SPureza:98%Forma y color:SolidPeso molecular:1507.68Acth (7-16)NH2
CAS:Acth (7-16)NH2 exhibits neurotrophic effects.Fórmula:C58H92N18O10Pureza:98%Forma y color:SolidPeso molecular:1201.47NY-BR-1 p904 (A2)
CAS:T-cell clones specific for this NY-BR-1 epitope (p904) can recognize breast tumor cells expressing NY-BR-1.Fórmula:C43H78N10O15Pureza:98%Forma y color:SolidPeso molecular:975.14Bim BH3, Peptide IV TFA (721885-31-0 free base)
Bim BH3, Peptide IV TFA is a 26-site residue of BH3 protein Bim, belonging to the pro-apoptotic group of bcl-2 protein family.Fórmula:C147H223N44F3O43SPureza:98%Forma y color:SolidPeso molecular:3383.67G280-9
CAS:G280-9 peptide: melanoma epitope for HLA-A2; recognized by T cells at low levels; low immunogenicity due to weak HLA-A2 affinity.Fórmula:C44H67N9O14Pureza:98%Forma y color:SolidPeso molecular:946.05OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Forma y color:SolidPeso molecular:1489.59Arfalasin
CAS:Arfalasin is a bioactive chemical.Fórmula:C48H67N13O11Pureza:98%Forma y color:SolidPeso molecular:1002.13Palmitoyl dipeptide-7
CAS:Palmitoyl dipeptide-7 is a peptide.Fórmula:C26H51N3O5Pureza:98%Forma y color:SolidPeso molecular:485.7Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Forma y color:SolidPeso molecular:3692.15
