Péptidos

Peptide Ac-PDEVKRKKKPYC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GILLPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

Peptide Biot-PICTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.

BID (BH3 Interacting Domain Death Agonist) is a pro-apoptotic protein and a member of the BH3-only family, which is part of the larger Bcl-2 family of proteins. BID plays a critical role in the regulation of apoptosis (programmed cell death) by linking two major pathways that trigger cell death: the extrinsic (death receptor-mediated) and intrinsic (mitochondria-mediated) pathways.BID is typically present in an inactive form in the cytosol. In response to death signals from the extrinsic apoptotic pathway, such as when death receptors (e.g., Fas or TNF receptors) are activated, BID gets cleaved by caspase-8. This cleavage produces a truncated, active form of BID called tBID (truncated BID). Once activated, tBID translocates to the mitochondria, where it interacts with pro-apoptotic Bcl-2 family proteins like Bax and Bak. This interaction causes mitochondrial outer membrane permeabilization (MOMP), leading to the release of cytochrome c and other apoptogenic factors from the mitochondria into the cytosol. The release of cytochrome c activates the caspase cascade, which ultimately leads to the execution of apoptosis.

H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GTVNLTWSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool