Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29608 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
HXB2 gag NO-48/aa189 - 203
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,614.9 g/molH-HLVQQEGQLEQQER^-OH
Peptide H-HLVQQEGQLEQQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 14
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,863 g/molH-FVTVTAEALR^-OH
Peptide H-FVTVTAEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLSLSLGK^-OH
Peptide H-SLSLSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DGVPVIK^-OH
Peptide H-DGVPVIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLYANTVL^SGGTTMYPGIADR-OH
Peptide H-DLYANTVL^SGGTTMYPGIADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDVDTLDMVFLDHWK^-OH
Peptide H-YDVDTLDMVFLDHWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Gly-Arg-Arg-AMC acetate salt
CAS:Boc-Gly-Arg-Arg-AMC acetate salt is a protease inhibitor that inhibits the activity of serine proteases. This protein is a potent and selective inhibitor of the NS3 protease from hepatitis C virus, which is responsible for the cleavage of polyproteins into mature proteins. Boc-Gly-Arg-Arg-AMC acetate salt has been shown to be effective in transfection experiments and polymerase chain reaction, as well as in inhibiting the activity of soybean trypsin and mammalian tissue proteases.
Fórmula:C29H44N10O7•(C2H4O2)xPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:644.72 g/molH-Trp-Lys-Tyr-Met-Val-Met-NH2
CAS:H-Trp-Lys-Tyr-Met-Val-Met-NH2 is a natural compound that belongs to the group of pharmacological agents. It has been shown to have a therapeutic effect on congestive heart failure, bowel disease and autoimmune diseases. This compound has also been shown to stimulate locomotor activity in mice by increasing dopamine levels in the brain. H-Trp-Lys-Tyr-Met-Val-Met NH2 has been found to inhibit the growth of HL60 cells in culture, which are a type of white blood cell that is involved in immune response. H-Trp-Lys Tyr Met Val Met NH2 also binds to receptors for formyl and sesquiterpenoid lactones, which are chemical compounds that are used as pharmacological agents for cancer therapy and treatment of inflammatory bowel disease.Fórmula:C41H61N9O7S2Pureza:Min. 95%Peso molecular:856.11 g/molCMVpp65 - 14 (PSLILVSQYTPDSTP)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,617.8 g/molH-YML^DLQPETT-OH
Peptide H-YML^DLQPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYPSDIAVEWESNGQPENNYK^-OH
Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELL^AHK-OH
Peptide H-YVYIAELL^AHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NIDGYFK^-OH
Peptide H-NIDGYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GDVAFVK^-OH
Peptide H-GDVAFVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Antennapedia peptide amide
Penetratin is a cell-penetrating peptide (CPP), also known as a protein transduction domain (PTD), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain. Penetratin linked to a phosphodiester oligonucleotide is capable of permeating through neuronal cell membranes and down-regulating genes.Peso molecular:2,245.75 g/molH-QMESQPLPGER^-OH
Peptide H-QMESQPLPGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CFTR (108-117), Pseudomonas aeruginosa Inhibitor
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C51H77N15O22Peso molecular:1,252.27 g/mol
