Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29595 productos de "Péptidos"
H-GHFPLAER^-OH
Peptide H-GHFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YVYIAELLAHK^-OH
Peptide H-YVYIAELLAHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[5-FAM]-beta-Amyloid (1-15) Human
Fluorescein labelled amyloid β 1-15 (Aβ1-15 ). Aβ1-15 is one of many short Aβ species found in vivo and is formed by the cleavage of Aβ precursor protein by β- and alpha-secretase.Amyloid β-protein (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Fluorescein (FAM) is a hugely popular fluorescent tag due to its excellent fluorescence quantum yield and relatively high absorptivity as well as being highly water soluble.Peso molecular:2,183.8 g/molH-AVIDDAFAR^-OH
Peptide H-AVIDDAFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HIV-1 gag Protein p24 (65-73) (isolates MAL/U455)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H79N11O14S2Peso molecular:1,050.31 g/molSAMS peptide
SAMS peptide was originally designed as a selective substrate for mammalian 5' adenosine monophosphate-activated protein kinase (AMPK) for use in kinase assays. However it is also able to be phosphorylated by the yeast AMP homologue- sucrose non-fermenting 1 kinase (SNF1) and SNF1-related kinases (SnRK1) in plants.The conserved family of kinases containing SnRK1, SNF1 and AMPK plays an important role in regulating cellular energy homeostasis.
Forma y color:PowderPeso molecular:1,779.15 g/molSARS-CoV-2 Membrane protein (172-188)
SARS-CoV-2 Membrane protein (172-188)
Forma y color:PowderPeso molecular:1,900 g/molSyntide 2
Syntide-2 is a substrate peptide which was specifically designed to be homologous to site 2 in glycogen synthase. Syntide-2 is therefore phosphorylated by Ca2+ calmodulin-dependent protein kinase II as well as other calcium dependant kinases and protein kinase C. Synthase-2 can also be phosphorylated by CAMP-dependent protein kinase and to a lesser extent- phosphorylase kinase, but not by myosin light chain kinase.
Forma y color:PowderPeso molecular:1,506.9 g/molH-DLATVYVDVLK^-OH
Peptide H-DLATVYVDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-IDMVD-OH
Peptide Ac-IDMVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEQY^NSTYR-OH
Peptide H-EEQY^NSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Azido-RKKRRQRRR-NH2
Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Infliximab Heavy chain (46-60)
Infliximab is a biologic medicine used in the treatment of numerous autoimmune diseases including Crohn disease, rheumatoid arthritis, and ankylosing spondylitis. Infliximab binds with high affinity to tumour necrosis factor-α (TNF-α) blocking most of the cytokine effects, which includes mediating the inflammatory responses. Infliximab is a chimeric human-mouse IgG monoclonal antibody- the constant regions of the heavy and light chains are human-derived. The heavy chain peptide (46-60) has been identified as an antigen for antigen-specific T cell analysis. Numerous methods of immunological analysis can be applied to this peptide to hopefully provide further insight to these autoimmune conditions.Peso molecular:1,689.9 g/mol5Fam-VIFDANAPVAVR-OH
Peptide 5Fam-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-KNIVTPRTPPPSQGK-NH2
Peptide LCBiot-KNIVTPRTPPPSQGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Glucagon (1-29)-[Cys(Cy5)]
Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.Peso molecular:4,189 g/molDystrophin (2765-2777)
Forms of inherited muscular dystrophy such as Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) result from mutations targeting the dystrophin gene. These disorders are X-linked, progressive, and cause the gradual weakening of the muscles leading to respiratory failure and ultimately reduces the patient lifespan.In DMD, mutations lead to the production of premature stop codons and hence the truncated dystrophin protein product is vulnerable to nonsense mediated decay and degradation. Therefore, dystrophin production in muscle cells is reduced. On the other hand, nonsense mutations which also contribute to DMD, cause exon skipping in BMD and result in an internally truncated protein product which are partially functional. The symptoms of BMD are later onset compared with DMD which develop in patients between 2 to 7 years.Treatments of dystrophin disorders are in clinical trial including antisense oligonucleotide exon skipping and gene therapy. However, the efficacies of these treatments are not easily quantified. Currently levels of muscular dystrophin are quantified by western blot which can be unreliable. The peptide provided here, aligning residues dystrophin (2690-2700), has been tested via mass spectrometry to provide a more reliable method of validation of dystrophin levels. Further study with this dystrophin fragment could prove to be a vital step in the understanding and treatment of dystrophin disorders. Within our catalogue we also have other peptides tested for dystrophin quantification available plus the full-length dystrophin protein.Peso molecular:1,401.7 g/molGHK tripeptide
CAS:The GHK tripeptide has many attributes which can positively impact human health. GHK can improve tissue repair, exhibit anti-cancer and anti-inflammatory properties, suppress age related molecules and restore chronic obstructive pulmonary disease fibroblasts.The GHK tripeptide is found in the human plasma and binds copper. It exerts its effects through its ability to up regulate and downregulate 4,000 human genes. Due to its ability to protect and regenerate aspects of human health, GHK-Cu can be used in products for skin and hair.Specifically during skin regeneration GHK-Cu can promote the synthesis of collagen and glycosaminoglycans, increase the rate of wound healing and the formation of blood vessels.
Fórmula:C14H24N6O4Forma y color:PowderPeso molecular:340.2 g/mol
![[5-FAM]-beta-Amyloid (1-15) Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100839.webp&w=3840&q=75)
![Glucagon (1-29)-[Cys(Cy5)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130431.webp&w=3840&q=75)
