Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29610 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
5Azido-RKKRRQRRR-NH2
Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLYASSPGGVYATR^-OH
Peptide H-SLYASSPGGVYATR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QVLQVTPFAER^-OH
Peptide H-QVLQVTPFAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Leu-Val-Val-Val-Gly-Ala-Asp-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C43H77N11O13Peso molecular:956.14 g/molH-SLLQLLIGL-OH
Peptide H-SLLQLLIGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H82N10O11Peso molecular:969.22 g/molH-KKKKKKKKKKKKKKKK-OH
Peptide H-KKKKKKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C96H192N32O16Peso molecular:2,068.77 g/molH-PRRVRLK-OH
Peptide H-PRRVRLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C40H75N17O7Peso molecular:924.15 g/molH-FLHVTYVPAQEKNFT-OH
Peptide H-FLHVTYVPAQEKNFT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C85H122N20O22Peso molecular:1,794.01 g/molH-SAPHGVVFL-OH TFA salt
Peptide H-SAPHGVVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C44H65N11O10Peso molecular:926.07 g/molBLf tryptic digestion peptide
BLf tryptic digestion peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C35H57N7O9Peso molecular:737.88 g/molH-MDILSYMR^-OH
Peptide H-MDILSYMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-ASQETFG-NHMe
Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2
Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLLSKSLVF-OH
Peptide H-GLLSKSLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C46H76N10O11Peso molecular:963.17 g/molH-TGWLGPFDYWGQGTLVTVSSASTK-OH
Peptide H-TGWLGPFDYWGQGTLVTVSSASTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C118H170N28O35Peso molecular:2,558.79 g/molH-SIPQVSPVR^-OH
Peptide H-SIPQVSPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SQVETEDLILKPGVVHVIDIDR-OH
Peptide H-SQVETEDLILKPGVVHVIDIDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C109H181N29O35Peso molecular:2,475.79 g/molH-DLDLEMLAPYIPMDDDFQLR-OH
Peptide H-DLDLEMLAPYIPMDDDFQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C107H162N24O34S2Peso molecular:2,410.72 g/molH-SGAQATWTELPWPHEK^-OH
Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLMSFPQSA-OH
Peptide H-HLMSFPQSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fórmula:C45H66N12O12SPeso molecular:1,017.16 g/mol
