
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29863 productos de "Péptidos"
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-DSGSSLIR^-OH
Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-K^AEEGDLLVNPDQPR^-OH
Peptide H-K^AEEGDLLVNPDQPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^F^-OH
Peptide H-R^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-IPESSELTLQELLGEERR-NH2
Peptide LCBiot-IPESSELTLQELLGEERR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CISQAVHAAHAEINEAGR-NH2
Peptide Ac-CISQAVHAAHAEINEAGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IP^TTFENGR^-OH
Peptide H-IP^TTFENGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-VHWDFRQWWQPS-OH
Peptide LCBiot-VHWDFRQWWQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYDLDPGAGSLEI^-OH
Peptide H-SYDLDPGAGSLEI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
rec IL-2 (human)
CAS:Please enquire for more information about rec IL-2 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%GRP (18-27) (human, porcine, canine)
Mammalian bombesin-like neuropeptide first isolated from pig spinal cord, which can stimulate rat uterine smooth muscle contraction and gastrin and somatostatin secretion in vitro. Increases blood pressure and pancreatic exocrine secretion in dogs.Forma y color:PowderPeso molecular:1,119.5 g/molAc-FHDDSDEDLLHI-OH
Peptide Ac-FHDDSDEDLLHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^LQSLQTYV-OH
Peptide H-R^LQSLQTYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-A^VLQ-OH
Peptide H-A^VLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVY^DGEEHSV-OH
Peptide H-GVY^DGEEHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.HXB2 gag NO-26
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,788 g/molThyroglobulin (Tg-FSP)
Thyroglobulin (Tg) is a widely used biomarker of various differentiated thyroid cancer (DTC)- Tg is a substrate for thyroid hormone production. Detection and quantification of serum thyroglobulin levels remain challenging due to Tg's size, heterogeneity, and thyroglobulin autoantibodies (TgAb). Immunoassays offer the opportunity to tailor DTC treatments, but many patients are TgAb positive, excluding them from analysis during regression.Liquid chromatography-tandem mass spectrometry (LC-MS/MS) can overcome immunoassay issues by digestion of Tg to a tryptic peptide removing the interference from TgAbs. The addition of a doubly charged peptide precursor ion, FSP peptide, allows easy detection of Tg-FSP by an anti-FSP antibody that is reliable and quantifiable.Peso molecular:1,405.7 g/molAc-GGLNDIFEAQKIEWHED-NH2
Peptide Ac-GGLNDIFEAQKIEWHED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
