Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 29773 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotin-Jak2 substrate
This peptide is phosphorylated by Janus kinase 2 and 3 (JAK2 and JAK3) and is an ideal substrate for use in kinase assays. The JAK family of kinases is essential for the signalling of a host of immune modulators in tumour, stromal, and immune cells where they are highly expressed. JAK family proteins mediate the signalling of the interferon (IFN), IL-6, and IL-2 families of cytokines.JAK kinases are associated with cytokine receptors. Cytokine binding to these receptors results in activation of JAK kinases and receptor phosphorylation. Phosphorylated cytokine receptors recruit STAT proteins, which are then phosphorylated by the activated JAK kinases. Phosphorylated STAT proteins form homo- and hetero-dimers that translocate into the nucleus and function as transcription factors.This peptide contains an N-terminal biotin tag for easy detection and purification.
Forma y color:PowderPeso molecular:1,782.96 g/molSARS-CoV-2 Nucleoprotein 2 (261-275)
The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. Also known as the nucleocapsid protein, it is an abundant RNA-binding protein critical for viral genome packaging. These factors make nucleoprotein a good target for developing new antiviral drugs. In addition, the identification of epitopes within the nucleoprotein sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. Nucleoprotein (261-275) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.Peso molecular:1,654.9 g/molH-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Galanin (2-30) acid
Galanin is predominantly an inhibitory neuropeptide expressed in humans and other mammals' brains, spinal cords, and gut. Galanin signalling occurs through three G protein-coupled receptors GalR1-3. Galanin has been implicated in many biologically diverse functions, including nociception, waking and sleep regulation, cognition, feeding, mood regulation and blood pressure regulation. Galanin appears to have neuroprotective activity as its biosynthesis is increased 2-10 fold upon axotomy and during seizure activity in peripheral tissues and the brain.The clinical relevance of galanin is related to several chronic neural disorders, including Alzheimer's disease, epilepsy, depression and cancer- those who suffer from type 2 diabetes mellitus, depression and Alzheimer's disease often express high levels of galanin. Conversely, intervention with galanin agonists (for example, M617, M1145 and M1153) were able to ameliorate disease symptoms such as Alzheimer's and have pro-nociceptive effects. Specifically, activation of GAL2 can alleviate such disease features in human and rodent models. This galanin (2-30) peptide has been used to characterise Galanin's binding sites and affinity for GALR receptors via competition binding analysis. Galanin (2-30) is a full agonist of the GALR2 receptor compared to its affinity for GALR1.Peso molecular:3,098.5 g/molH-GLKEIFKAGLGSLVKGIAAHVAS-NH2
Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CALP3 - Calcium like peptide 3
CAS:Cell-permeable calmodulin (CaM) agonist that binds to the EF-hand/Ca2+-binding site and can activate phosphodiesterase in the absence of Ca2+ and inhibit Ca2+ mediated cytotoxicity and apoptosis.Fórmula:C44H68N10O9Peso molecular:881.07 g/molSuc-Ala-Val-Pro-Phe-pNA
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C32H40N6O9Peso molecular:652.7 g/molH-YFIDFVAR^-OH
Peptide H-YFIDFVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH
Peptide 5FAM-GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Shepherdin (79 - 87)
Shepherdin is an antagonist of the interaction between the apoptosis protein, survivin, and the molecular chaperone, heat shock protein 90 (Hsp90). The sequence of shepherdin corresponds to the site where Hsp90 binds to survivin. Shepherdin therefore has high affinity for Hsp90 and thus disrupts survivin binding and acts as an inhibitor of Hsp90 ATPase function by competing with ATP.The survivin-Hsp90 complex is a regulator of cell proliferation and cell viability in cancer tissue. Shepherdin has anti-cancer properties and can significantly suppress the growth of lung cancer cell lines and acute myeloid leukaemia (AML) by inducing apoptosis.Forma y color:PowderPeso molecular:948.4 g/molARF peptide
ARF peptide, is the alternative frame (ARF) tumour suppressor protein which is expressed on the occurrence of oncogenic stimuli. It functions to prevent abnormal cell proliferation through inhibiting the p53 ubiquitin ligase protein Mdm2 from degrading p53. This results in the increased stability of the p53 tumour suppressor causing G1 cell cycle arrest. Additionally mouse ARF proteins can localise E2F1 and c-Myc transcriptions factors to the nucleolus therefore they are no longer able to activate S-phase promoting target gene. Again this results in cell cycle arrest, ultimately preventing tumour cell growth. It is evident that if the expression of the ARF peptide is inhibited tumour formation is more likely to occur.Forma y color:PowderPeso molecular:1,867.1 g/molPremelanosome Protein (PMEL) (C-Term)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolN-formylated PSMalpha2
Pathogenic Staphylococcus aureus strains produce N-formylmethionyl containing peptides. Peptides starting with an N-formylated methionyl group constitute a unique hallmark of bacterial as well as mitochondrial metabolism, and professional phagocytes of our innate immune system recognise this microbial/mitochondrial pattern as a danger signal that guides innate immune cells.All PSMα peptides have the same basic functions and promote virulence through effects on discrete neutrophil functions (i.e. chemotaxis) and by being cytotoxic at higher concentrations. PSMα2 and PSMα3 can both bind to FPR2 and trigger superoxide release in neutrophils at low nanomolar concentrations. In addition, at high nanomolar concentrations they display cytotoxicity selectively on apoptotic neutrophil membranes and this occurs in an FPR2 independent manner.Forma y color:PowderPeso molecular:2,304.4 g/molH-RF^-OH
Peptide H-RF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.3x FLAG peptide
The synthetic canonical Flag sequence has been shown to be most effective with the Asp-Tyr-Lys-Xaa-Xaa-Asp motif triplicated for applications in protein analysis followed by the eight amino acids at the C-terminus of the classic FLAG sequence (Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys). Due to the hydrophilic nature of the peptide the Flag tag typically resides on the surface of the recombinant protein thus minimising any effects on the function or transport of the fusion protein. The tag can be used in conjunction with other tags such as HA or myc depending on the application. FLAG is an artificial antigen to which high affinity monoclonal antibodies have been raised, therefore allowing for highly effective protein purification by affinity chromatography as well as accurate localisation of FLAG tagged proteins within living cells, or Western blots. FLAG peptide can be used to effectively purify complexes with multiple proteins as its mild purification procedure tends not to disrupt such complexes. It can be used to obtain proteins of sufficient purity for x-ray crystallography. The 3 x Flag peptide provides powerful detection and purification of recombinant proteins that has been characterised in numerous applications including affinity chromatography, binding assays and structural analysis.Peso molecular:3,649.8 g/molKinetensin
Kinetensin was originally isolated from pepsin-treated plasma, and it shares some sequence homology with the C-terminal end of neurotensin (NT), having four of its nine amino acids in common with NT. Kinetensin is a potent histamine releaser and therefore may serve as an inflammatory mediator, it also has a role as a human metabolite and can increases vascular permeability. Kinetensin can be cleaved by ACE2.
Peso molecular:661.4 g/mol5Fam-LPYEGSLLLKLLRAPVEEV-OH
Peptide 5Fam-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.R5
The peptide R5 is made up of 19 amino acids and it precipitates SiO2 nanostruture silica, using its RRIL motif. It is one of the repetitive peptide sequences forming the protein silaffin sillp in Cylindrotheca fusiformis, a marine diatom.Peso molecular:2,012.1 g/molH-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Dnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
