
Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30306 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-CAEAETAKDN-OH
Peptide Ac-CAEAETAKDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GEGIEEFLR^-OH
<p>Peptide H-GEGIEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLGYLEQLLR^-OH
<p>Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MeOSuc-Ala-Ala-Pro-Met-AMC
CAS:MeOSuc-Ala-Ala-Pro-Met-AMC is a substrate for the aminopeptidase. It has been shown to have minimal effects on intestinal cells and analyzed peptidases, proteolytic peptidases, and aminopeptidases. This compound is not pathogenic and can be used as a modulator of oncospheres and parasites.Fórmula:C31H41N5O9SPureza:Min. 98 Area-%Forma y color:PowderPeso molecular:659.75 g/molH-ESLSSYWESAK^-OH
<p>Peptide H-ESLSSYWESAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>β-Amyloid (37-43)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Fórmula:C27H49N7O9Peso molecular:615.73 g/molH-DPEGVPPLLVSQQAK^-OH
<p>Peptide H-DPEGVPPLLVSQQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Peso molecular:1,740 g/molH-RWKFGGFKWR^-OH
<p>Peptide H-RWKFGGFKWR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(4S)-4-[[(2S)-3-Carboxy-2-[[(2S,3R)-2-[[(2R)-2-[[(2S,3S)-2-[[(2S)-3-carboxy-2-[[(2R)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-sulfanylp ropanoyl]amino]propanoyl]amino]-3-methylpentanoyl]amino]-3-sulfanylpropanoyl]amino]-3-hydroxybutanoyl]amino]propanoyl]amin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C44H68N10O18S2Peso molecular:1,089.2 g/molBoc-LGR-OH
Peptide Boc-LGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPTFIPAPIQAK^-OH
<p>Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATYPLPIRC-NH2
<p>Peptide H-ATYPLPIRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Glu-Glu-Leu-OH
CAS:H-Glu-Glu-Leu-OH is a vitamin that is essential for the production of hydroxyproline, which aids in the formation of collagen. It is also used to treat osteoarthritis and rheumatoid arthritis. H-Glu-Glu-Leu-OH is synthesized from glutamate, glutamic acid, and leucine in the liver and kidney. This reaction proceeds by two steps: first, glutamate carboxylase converts glutamate to α-ketoglutarate; then, aspartate aminotransferase converts α-ketoglutarate to aspartate semialdehyde. Aspartate semialdehyde is converted to H-Glu-Glu-Leu by an enzyme called glutamyl aminopeptidase. The reaction mechanism of this enzyme has been studied experimentally and theoretically using sodium bicarbonate (NaHCO) as a buffer. The sequential natureFórmula:C16H27N3O8Pureza:Min. 95%Forma y color:White Off-White PowderPeso molecular:389.40 g/molH-SSPVVNDGVVR^-OH
<p>Peptide H-SSPVVNDGVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).H-LNIPTDVLK^-OH
<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-PQDKEYYKVKE-OH
Peptide LCBiot-PQDKEYYKVKE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIIQFEKL-OH
<p>Peptide H-SIIQFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SISIVGSYVGNR^-OH
<p>Peptide H-SISIVGSYVGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
