
Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29699 productos de "Péptidos"
SIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,695 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FEDGVLDPDYPR^-OH
Peptide H-FEDGVLDPDYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C66H97N12O24PPeso molecular:1,473.57 g/molFmoc-D-Ala-Wang Resin (100-200 mesh) 1% DVB
Fmoc-D-Ala-Wang resin is an inhibitor that binds to the active site of peptidyl-serine and peptidyl-threonine phosphatases, which are enzymes that remove phosphate groups from proteins. This resin has been shown to inhibit protein phosphatase 1 and 2A in vitro. Fmoc-D-Ala-Wang resin can be used as a research tool for the study of protein interactions, ligand receptor interactions, or ion channels. Fmoc-D-Ala Wang resin is also used as a high purity reagent for the synthesis of peptides or proteins.Pureza:Min. 95%HXB2 gag NO-38/aa149 - 163
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Peso molecular:1,740 g/mol(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C42H74N10O12SPeso molecular:943.18 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C99H155N31O23Peso molecular:2,147.5 g/molAc-CRIGLLGHPPHMNVNPQQPA-OH
Peptide Ac-CRIGLLGHPPHMNVNPQQPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C13H24N4O6S1Peso molecular:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Atrial natriuretic factor (1-28) trifluoroacetate
CAS:Please enquire for more information about Atrial natriuretic factor (1-28) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C127H203N45O39S3•C2HF3O2Pureza:Min. 95%Forma y color:PowderPeso molecular:3,194.47 g/molH-FLASVSTVLTSK^-OH
Peptide H-FLASVSTVLTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGDNNL^TRIVGGQE-OH
Peptide H-RGDNNL^TRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YLFSVHWPPLKA-NTBiot
Peptide H-YLFSVHWPPLKA-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PALEDLR^-OH
Peptide H-PALEDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,624.8 g/mol
