Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29977 productos de "Péptidos"
H-SQLTKPISSLTKPYH-OH
Peptide H-SQLTKPISSLTKPYH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YKVVKIEPL-OH
Peptide H-YKVVKIEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CTASNKNRGIIKTFS-OH
Peptide H-CTASNKNRGIIKTFS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YIPEITLPV-OH
Peptide H-YIPEITLPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGDFGLATK-OH
Peptide H-IGDFGLATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SQIMYNYPA-OH
Peptide H-SQIMYNYPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CEKAHDGGR-OH
Peptide H-CEKAHDGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLKGPDIYKGVYQFKSVEFD-OH
Peptide H-GLKGPDIYKGVYQFKSVEFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH
Peptide H-KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLQCVDLHV-OH
Peptide H-KLQCVDLHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYIHAF-OH
Peptide H-DRVYIHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIIAYTMSL-OH
Peptide H-SIIAYTMSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTSPRHLSNVSSTGSI-OH
Peptide H-DTSPRHLSNVSSTGSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NTRPPLGNW-OH
Peptide H-NTRPPLGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AAHTEDINACTLTTSPR-OH
Peptide H-AAHTEDINACTLTTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVSEIQLMHNLGK-OH
Peptide H-SVSEIQLMHNLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DREQAPNLVY-OH
Peptide H-DREQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VVGACGVGK-OH
Peptide H-VVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AMKRHGLDNYRGYSL-OH
Peptide H-AMKRHGLDNYRGYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RSDSGQQARY-OH
Peptide H-RSDSGQQARY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
