Péptidos

<p>Blocker of Nav1.4 channels</p>

<p>Blocker of Nav1.7 channel</p>

<p>Blocker of voltage-gated sodium channels</p>

<p>Ryanodine receptors agonist</p>

<p>Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 395-430 peptide. SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

<p>Blocker of A-type potassium channels</p>

<p>Selective blocker of insects calcium channels</p>

<p>MOG (183-191) FVIVPVLGP</p>

NH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.

<p>GLP-1 (Human, Rat, Mouse)-EIA Kit is a ready-to-use kit that contains a recombinant human GLP-1 peptide. This kit is designed for the quantitative measurement of GLP-1 in human serum or plasma by ELISA. It uses a polyclonal antibody to detect the protein and has no cross-reactivity with other pancreatic hormones. The assay can be used with rat and mouse samples as well.</p>

<p>C-Peptide (Mouse)-EIA Kit is a mouse C-peptide EIA kit. It is designed for the quantitative measurement of C peptide in serum samples from mice. The kit contains an antibody that recognizes mouse C peptide, and a conjugate that binds to the antibody. The kit also contains a biotin-labeled anti-mouse IgG antibody, which reacts with the conjugate to form a complex that is subsequently detected by an enzyme-conjugated streptavidin. The amount of complex formed is proportional to the amount of C peptide present in the sample.</p>

<p>Anti-Substance P Serum is a high purity protein that specifically binds to the receptor for substance P, which is a peptide hormone. This product has an affinity for the high affinity binding site of the receptor and inhibits the activity of substance P. Anti-Substance P Serum is used as a research tool in pharmacology and cell biology, as well as in antibody production.</p>

<p>Amyloid beta-protein (Aβ) is a peptide that is associated with Alzheimer's disease. It is a research tool for understanding the biology of Aβ. The Aβ peptide has been shown to activate a number of receptors and ion channels, including the nicotinic acetylcholine receptor, which may be due to its ability to bind to these proteins with high affinity. Amyloid beta-protein has also been shown to bind antibodies, which may be due to its ability to act as an antigen. Amyloid beta-protein inhibits the function of ion channels and can be used in pharmacological studies as a tool for understanding how this protein interacts with other proteins.</p>

Ac-Asp-Glu • H2O is a water soluble molecule that belongs to the class of inhibitors. It has been shown to inhibit the polymerase chain reaction and is used as an analytical method for detecting DNA sequences. Ac-Asp-Glu • H2O induces neuronal death in the caudate putamen, thereby causing bowel disease, by inhibiting energy metabolism. This compound also inhibits the synthesis of proteins in the hippocampus, which leads to reduced locomotor activity and eosinophil cationic protein production. Ac-Asp-Glu • H2O is acidic and its concentration–time curve shows a bell shape. The half life of this compound is six hours.

<p>Chromogranin A (Human, 286-301 Amide) is a protein that belongs to the class of peptides. It is a major component of the chromaffin granules in the adrenal medulla and in neuroendocrine cells in various parts of the brain. There are two types of chromogranin A, which have 286-301 amino acids. Chromogranin A is an activator for G-protein coupled receptors, ion channels, and ligands. This protein has been used as a research tool in Cell Biology and as an inhibitor in Pharmacology.</p>

<p>AIP-I is a peptide that is an activator of ion channels. The AIP-I peptide is a synthetic analog of the natural ligand, AIP-II. It has been shown to be a potent inhibitor of voltage-gated potassium channels in human embryonic kidney cells and has also been used as a research tool for studying protein interactions and receptor pharmacology.</p>

<p>BNP-26 is a non-peptide, small molecule that regulates ion channels. It binds to the receptor site of ligand-gated ion channels and inhibits the binding of neurotransmitters to the receptor. BNP-26 is an inhibitor that blocks the activation of phospholipase C (PLC) and protein kinase C (PKC), which are enzymes that regulate cell proliferation, differentiation, and apoptosis. BNP-26 is also an antibody cross-linker with high purity and CAS No. 114547-28-3.</p>

Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) is a peptide that is a cell biology research tool. It is an inhibitor of protein interactions, activator, ligand or receptor. Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) has high purity and is suitable for life science research. Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) can be used as an ion channel inhibitor in pharmacology studies. Ac Val Asp Val Ala Asp H (aldehyde) also functions as an antibody to a protein of interest.

<p>Bis-dPEG®25-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®25-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>Azido-dPEG® 11-amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 11-amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Sar1, Ile4,8]-Angiotensin II is a peptide that belongs to the class of angiotensins. It has been shown to activate angiotensin receptors and is used as a research tool in pharmacology and cell biology. Sar1, Ile4,8]-Angiotensin II interacts with ligands such as heparin-binding EGF-like growth factor (HB-EGF) and angiopoietin 1 (ANGPT1). The antibody against Sar1, Ile4,8]-Angiotensin II blocks the receptor binding activity of this peptide. Sar1, Ile4,8]-Angiotensin II has been shown to be an inhibitor of ion channels such as inward rectifier potassium channels.</p>

Azido-dPEG®24-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®24-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.

<p>Oxytocin is a peptide hormone that is produced by the hypothalamus and released by the pituitary gland. It is used to induce labor, control postpartum bleeding and stimulate milk production. Oxytocin also plays a role in sexual arousal, social recognition, and trust. It has been shown to have an inhibitory effect on many types of ion channels, including those found in the heart, central nervous system, and blood vessels. Oxytocin binds to receptors that are found throughout the body and brain. The receptor for oxytocin is known as OXT. This receptor belongs to the G-protein coupled receptor family of receptors. Oxytocin was first isolated from sheep serum in 1906 by Henry Dale and Charles Robert Harington. It was later synthesized in 1953 by Vincent du Vigneaud. This product has disulfide bonds between Cys1-Cys6.</p>

<p>Fmoc-Phe-OH is a peptide that has been used as a research tool to study protein interactions. This molecule can be used in the inhibition of cellular processes and has been shown to activate the ATPase activity of Na,K-ATPase. Fmoc-Phe-OH is also a ligand that binds to receptors, such as the GABA receptor, through ion channels. This compound may also be used in antibody production or as an immunogen.</p>

<p>MAL-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

Cyclo(Arg-Gly-Asp-D-Phe-Val) is a peptide inhibitor of protein interactions. It binds to the ligand binding site of receptor and inhibits the activation of this receptor. Cyclo(Arg-Gly-Asp-D-Phe-Val) also binds to antibodies and can be used as a research tool for identifying antibody targets.

An opioid peptide derived from the polypeptide pro-opiomelanocortin and binds to opioid receptors. It is involved in morphinomimetic behavior and physiologic activities. This product is available as a 0.5mg vial.

<p>Bis-dPEG®5-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®5-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>Angiotensin III (Human) is a peptide that is an inhibitor of angiotensin-converting enzyme. It has been used in research to study protein interactions and receptor binding, as well as to isolate antibodies against this protein. The peptide is a high purity product with a CAS number of 13602-53-4.</p>

<p>4-Formyl-Benzamido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Bis-ACV is a synthetic compound that has the ability to act as a carbon source for filamentous fungi. It can also be used to regulate the expression of genes and enzymes in filamentous fungi. Bis-ACV has been shown to increase the production of cytosolic calcium, thereby stimulating enzyme activities in various organisms. It is an oligosaccharide with a molecular weight of 548 Daltons and contains two acetyl groups, which are attached to glucose residues on the same side of the molecule. The biological sample was purified by HPLC and the subunits were identified by mass spectrometry. The sequence analysis revealed that Bis-ACV is composed of repeating units that have the structure of N-acetylglucosamine linked via alpha (1-&gt;4) glycosidic bonds.</p>

A synthetic spider toxin, sourced from the Funnel Web Spider, Agelenopsis aperta. This toxin can be applied as a P-type Ca2+ channel selective blocker and has disulfide bonds between Cys4-Cys20, Cys12-Cys25,Cys19-Cys36 and Cys27-Cys34. This product is available as a 0.1mg vial.

<p>SARS Coronavirus is an enveloped virus containing 3 outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein takes part in the virus infection cycle and is the primary target of neutralizing antibodies. SARS Spike produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 219 amino acids (306-515 aa) and having a molecular mass of 24.7kDa.SARS Spike is fused to a 6 amino acid His tag at C-terminus and purified by proprietary chromatographic techniques. The formulation of the SARS Spike (306-515) solution (0.5mg/ml) contains Phosphate-Buffered Saline (pH 7.4) and 10% Glycerol. Biological Activity: Measured by its binding ability in a functional ELISA with Human ACE-2 (CAT# enz-1159).<br>One-Letter Formula: ADPRVVPSGD VVRFPNITNL CPFGEVFNAT KFPSVYAWER KKISNCVADY SVLYNSTFFS TFKCYGVSAT KLNDLCFSNV YADSFVVKGD DVRQIAPGQT GVIADYNYKL PDDFMGCVLA WNTRNIDATS TGNYNYKYRY LRHGKLRPFE RDISNVPFSP DGKPCTPPAL NCYWPLNDYG FYTTTGIGYQ PYRVVVLSFE LLNAPATVCG PKLHHHHHH</p>

<p>Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Diamido-dPEG®11-Diamine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Diamido-dPEG®11-Diamine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MAL-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MAL-dPEG®2-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>D-Ala2,Met5]-Enkephalinamide is a potent endogenous opioid peptide that binds to opioid receptors and has been shown to have both antinociceptive and depressant effects. It has been shown to be effective in a model system of pain, acting on the descending antinociceptive pathway from the rostral ventromedial medulla (RVM) to the spinal cord. D-Ala2,Met5]-Enkephalinamide has also been observed to inhibit locomotor activity in CD1 mice at sub-effective doses. D-Ala2,Met5]-Enkephalinamide has been shown to act through activation of both G protein-coupled mu opioids receptors and G protein-coupled delta opioid receptors.</p>

<p>Lipoamido-dPEG®4-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®4-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>

<p>Z-Ala-Ala-Asn-AMC is a peptide that can be used as an inhibitor, activator, or ligand for protein interactions. It is also a research tool and antibody production reagent. This compound has high purity and is suitable for both in vitro and in vivo research.</p>

<p>2-NBDLG is a potent activator of ion channels, which are membrane proteins that allow the passage of ions across biological membranes. It binds to receptor sites on the cell surface and opens ligand-gated ion channels in the plasma membrane, thereby increasing the permeability of the membrane to sodium ions. 2-NBDLG has been shown to inhibit voltage-gated potassium channels and calcium ion (Ca2+) currents in vitro. This drug also has an affinity for various peptides such as bradykinin and substance P. 2-NBDLG is a high purity product with a CAS number of 174844-42-9.</p>

<p>Cl-Ac-(OH)Leu-Ala-Gly-NH₂ is a peptide with a molecular weight of 736.2 Da. It is an inhibitor of the enzyme protein kinase C (PKC). Cl-Ac-(OH)Leu-Ala-Gly-NH₂ has been shown to activate PKC by binding to specific domains in the enzyme, which leads to the phosphorylation and activation of PKC's regulatory subunits. This peptide can be used as a research tool in studies involving PKC and also as an antibody carrier for Western blotting and immunohistochemistry.</p>

<p>Bis-MAL-Lysine-dPEG®4-Acid is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>

<p>t-boc-N-Amido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion. See also GRF (1-29); sermorelin, a shorter fragment. Sequence alignments: porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Angiotensin II (Human) is a peptide that is produced by the renin-angiotensin system. It has been shown to be an effective inhibitor of the cell adhesion molecule CD44, and can also stimulate the proliferation of cells in culture. Angiotensin II (Human) is a ligand for angiotensin receptors, which are found on many different types of cells. The binding of angiotensin II to these receptors stimulates the production of cyclic AMP, which causes vasoconstriction and increased blood pressure.</p>

<p>Gly-Pro-pNA • Tos is a peptide that is derived from the sequence of the human beta2 adrenergic receptor. It can be used as a research tool for studying receptor-ligand interactions and for identifying ligands for other receptors. Gly-Pro-pNA • Tos may also be used as an inhibitor of ion channels.</p>

<p>Fmoc-OSu is a synthetic amino acid that is used in the synthesis of peptides and other biomolecules. It can be synthesized by solid-phase peptide synthesis using Fmoc chemistry, which involves an acid-labile protecting group. Fmoc-OSu has been shown to inhibit cancer cell growth, although its mechanism is not known.<br>Fmoc-OSu has been shown to have anti-inflammatory effects by inhibiting the proinflammatory cytokine TNFα.<br>Fmoc-OSu has also been shown to have glycan binding properties, which may be due to its ability to bind with sialic acid residues on glycoproteins or glycolipids.</p>

<p>Azido-dPEG®8-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®8-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>CCK-Octapeptide (26-33) is a peptide that is a member of the cholecystokinin family of peptides. CCK-Octapeptide (26-33) is an activator of the CCK receptor and can be used for research purposes. This peptide has been shown to inhibit ion channels, which are proteins that regulate the flow of ions across cell membranes, and may be used as a pharmacological tool or research tool.</p>

<p>Bis-dPEG®7-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®7-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>m-dPEG®24-Azide (Azido-m-dPEG®24) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Azide (Azido-m-dPEG®24) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MAL-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

dPEG®4 SATA (S-Acetyl-dPEG®4 NHS Ester) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®4 SATA (S-Acetyl-dPEG®4 NHS Ester) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

<p>Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) is an ion channel activator with a molecular weight of 921.5 Da. It has been shown to activate the voltage-gated potassium channels Kv1.2 and Kv1.3 in rat cortical neurons, and inhibit the activity of the voltage-gated sodium channels Nav1.6, Nav1.7, and Nav1.8 in rat dorsal root ganglia neurons. In addition, Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) has been shown to activate the calcium release activated calcium channels (CRACs) in human erythrocytes and induce the release of arachidonic acid from human platelets. It is a high purity reagent for research purposes only, not for use in humans or animals for any reason other than scientific research</p>

<p>m-dPEG®4-Azide (Azido-m-dPEG®4) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Azide (Azido-m-dPEG®4) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Amyloid beta-Protein (Human, 25-35) is the shortest amyloid fragment that forms β-sheet fibrils, while retaining toxicity, and may also induce the aggregation of N-tau protein and N-tau peptide 1/2R. Consequently this peptide may play a role in the pathogenesis of Alzheimer's disease, a neurodegenerative disorder that affects memory and cognitive function.<br>This product is available as a trifluoroacetate salt and as a 0.5mg vial.</p>

<p>CoV-2 IgG S1 antibody binds to both SARS-CoV and SARS-CoV-2 (COVID-19) with high affinity at amino acids 318-510 in the S1 domain of the Spike protein and can be used in ELISA assays. SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies. It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.<br>Recombinant Anti Human SARS CoV-2 IgG1 Kappa Spike S1 is a recombinant monoclonal antibody derived from HEL293 cells, which recognizes the SARS-CoV and SARS-CoV-2 Spike glycoprotein. CoV-2 IgG S1 Antibody binds to both SARS-CoV and SARS-CoV-2 with high affinity at amino acids 318-510 (RBD, Receptor Binding Domain) in the S1 subunit of the Spike protein.  The native monoclonal antibody was generated by sequencing peripheral blood lymphocytes of a patient exposed to the SARS-CoV.  The ELISA Plate was coated with the target proteins at 5 µg/ml. Primary antibodies were titrated on a 3-fold serial dilution starting at 125 ng/ml,  CoV-2 IgG S1 antibody recognises SARS-CoV-2 spike protein subunit 1 (aa 1-674), or 41.6 ng/ml CoV-2 IgG S1 antibody recognised spike protein from SARS-CoV (subunit 1, aa 1-666) and SARS-CoV-2 (subunit 1, aa 1-674). Secondary antibody anti-human IgG conjugated to HRP used in the assay, at 1:4000 concentration. This product was purified through Protein A affinity and avaiable in the formulation: 1mg/ml in PBS and 0.02% Proclin 300F.</p>

NHS-m-dPEG® (MW = 509) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® (MW = 509) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

<p>Boc-Phe-Ser-Arg-AMC is a peptide that can be used as a research tool in the study of protein interactions, receptor activation and ligand binding. It is an inhibitor of ion channels and has been shown to be an antagonist of nicotinic acetylcholine receptors. This product may be used as a research tool for studying cell biology, pharmacology, and life sciences.</p>

<p>Somatostatin is a peptide hormone that is produced by the hypothalamus and inhibits the release of growth hormones, stimulates the release of insulin from the pancreas, and inhibits the release of glucagon from the pancreas. Somatostatin also has biological properties that inhibit neuronal death in combination therapy groups. It has been shown to have cell factor activity which may contribute to its antitumor activity. Somatostatin also has pro-apoptotic properties in vitro assays at physiological levels, making it an excellent target for cancer therapy.</p>

<p>Biotin-dPEG®3-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®3-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>MAL-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>t-Boc-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-Boc-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Suc-Gly-Pro-Leu-Gly-Pro-AMC is a high purity, monoclonal antibody that can be used as a research tool or as an inhibitor. It has been shown to inhibit ion channels and protein interactions. Suc-Gly-Pro-Leu-Gly-Pro-AMC is also known as a ligand for the receptor. It has been shown to activate the receptor and cause a change in the cell membrane permeability by increasing calcium flux, which leads to an increase in intracellular calcium levels. Suc-Gly-Pro-Leu-Gly-Pro-AMC is found in Cell Biology and Pharmacology research studies.</p>

<p>MAL-dPEG®4- NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4- NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

Azido-dPEG®Sub>8-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®Sub>8-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

<p>Beta-casomorphin-5 (BCM-5) is a peptide that is released from the digestion of casein in milk. It is an analog of casomorphin-7, which has been shown to have opioid activity. BCM-5 has been found to inhibit the proliferation of cells and induce apoptosis by binding to P21, a protein that controls the cell cycle. BCM-5 also binds to the mu-opioid receptor and inhibits gastric acid secretion. The conformational properties of BCM-5 have been determined with analytical methods such as LC/MS/MS, NMR, and FTIR. These studies have shown that BCM-5 adopts a ß-sheet conformation when bound to mucin glycoprotein or other proteins.</p>

<p>Ser-Gln-Asn-Tyr-Pro-Ile-Val is a synthetic peptide. It has been shown to act as a competitive inhibitor of the GABA receptor, specifically in the alpha3 subunit. This inhibition has been found to be competitive with respect to GABA and benzodiazepine binding. Additionally, Ser-Gln-Asn-Tyr-Pro-Ile-Val has been shown to inhibit ion channels that are activated by extracellular potassium ions, such as KV7.1 and KV7.2 potassium channels.</p>

<p>NPY is a peptide that belongs to the family of neuropeptides. It is an endogenous regulator of appetite and energy expenditure in the central nervous system, which has been shown to act as a neurotransmitter and neuromodulator. NPY is also an activator of ion channels, such as potassium channels, sodium channels, and calcium channels. NPY has been shown to bind with high affinity to receptors in the brain, heart, lungs, kidneys, and intestines. The binding of NPY to its receptor leads to activation of protein interactions. This process can lead to changes in cell physiology or regulation of physiological functions by altering gene expression or changing the concentration of ions in the blood. NPY has also been shown as an inhibitor for many different ligands and receptors including dopamine D1 receptors and serotonin 5-HT2A/C receptors.</p>

<p>MOCAc-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-NH₂ is a protein inhibitor with a molecular weight of 1405.8 g/mol. It has a CAS number of 129857-88-6 and is available at high purity. MOCAc-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-NH₂ is used in research as an inhibitor, activator, or ligand for proteins. This product has been used in the study of ion channels, receptor binding, and cell biology.</p>

<p>MSH-Release Inhibiting Factor (MRIF) has been shown to be a potent inhibitor of the release of proinflammatory cytokines. It is derived from the acid methyl ester of mouse serum, and has been shown to inhibit the release of tumor necrosis factor-α (TNF-α) in animal studies. MRIF has also been shown to have anti-diabetic effects in mice. MRIF inhibits the production of inflammatory cytokines by blocking TNF-α at a molecular level. This protein binds to progesterone receptor and prevents it from interacting with its ligand, which is necessary for cancer cell growth. The expression system for this protein is E. coli, and it can be used as an immunosuppressant in animal studies.<br>MRIF also blocks TNF-α activity by inhibiting transcriptional activation of NFκB and AP-1, which are proteins that regulate gene expression.</p>

Methionine-Enkephalin is a peptide that is derived from the amino acid methionine. It has been shown to act on ion channels and the receptor, as well as having a number of other biological effects. Methionine-Enkephalin can be used in research for pharmacology and protein interactions. This product is an antibody against methionine-enkephalin. It can be used for cell biology and immunology research, as it recognizes the peptide sequence of methionine-enkephalin. This antibody can also be used to inhibit the activity of this peptide.

m-dPEG®8-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.While bats are probably the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The HEK293-derived recombinant protein contains the Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-681 fused to Fc tag at C-terminal having a M.W. of 76 kDa. PNTA Sepharose-Affinity Purification was used to purify the product which is avaiable as the formulation: CoV-2 S1 protein solution is supplied PBS pH 7.4.

<p>PACAP27 is a peptide that is used as a research tool. PACAP27 binds to the receptor for pituitary adenylate cyclase-activating polypeptide (PACAP). The binding of PACAP27 to the receptor leads to activation of adenylyl cyclase, which increases intracellular levels of cAMP. This increase in cAMP may lead to cellular responses such as increased ion channel activity and increased protein synthesis.</p>

<p>Adrenomedullin (human) is a research tool that has been shown to activate the ligand receptor. It is a member of the vasoactive peptide family, which includes adrenalin and noradrenaline. Adrenomedullin binds to the cell surface receptors on smooth muscle cells and endothelial cells and activates ion channels. This research tool is also known as AM.</p>

<p>m-dPEG®4-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

This Neuroendocrine Regulatory Peptide-1 (human) product can be used as an endogenous suppressor of vasopressin release and is available as a 0.1mg vial. The neuroendocrine regulatory peptide-1 (NERP1) is derived from VGF and it colocalizes with vasopressin in the hypothalamus and it has been found that NERPs prevent vasopressin release from the hypothalamus. Thus NERP1 is involved in body fluid homeostasis through modulating the release of vasopressin.

<p>Thiol-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>APETx2 is a peptide that belongs to the inhibitor class of protein interactions. It has been shown to inhibit the activation of beta-adrenergic receptors by preventing the binding of the ligand, which is a catecholamine. APETx2 also has been shown to be an activator for muscarinic acetylcholine receptors. This peptide is a high purity research tool that can be used as an antibody conjugate in immunohistochemical and immunoprecipitation assays.</p>

<p>t-boc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Beta-Sheet Breaker Peptide iAß5 is a peptide that interacts with amyloid beta proteins to disrupt the formation of beta sheets. It has been shown to inhibit the aggregation of amyloid beta proteins into oligomers and fibrils, and disrupts the self-assembly of amyloid beta protein into various conformations. Beta-Sheet Breaker Peptide iAß5 is a ligand for both receptor and activator binding sites on amyloid beta proteins, inhibiting the interaction of these sites. This inhibits the activation of downstream signalling pathways associated with Alzheimer's disease.</p>

<p>Azido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Poly-L-Lysine Hydrochloride is a synthetic polymer that has been shown to inhibit the growth of cancer cells. It has also been shown to be effective in preventing neuronal cell death, as well as toxicity caused by exposure to high levels of water vapor. Poly-L-Lysine Hydrochloride can be used as an anticancer agent and has a synergistic effect with other drugs. This polymer is thought to work by blocking the synthesis of DNA, RNA, and proteins, which are vital for the cell's survival.</p>

<p>Hydroxy-dPEG®6-t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®6-t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Angiotensin I (Bovine) is a synthetic substrate that is used for the measurement of Angiotensin I-converting enzyme activity in vitro. It has been incubated with rat or bovine tissue and can be used as a chromatographic standard. This substrate binds to the active site of the enzyme and undergoes hydrolysis, which generates an increase in pH. The resulting product is then measured fluorimetrically by measuring the decrease in absorbance at 350 nm. This peptide has been found to have a pressor effect and an inhibitory effect on acid secretion.</p>

<p>Des-Acyl Ghrelin (Human) is a Des-Octanoylated Ghrelin product available in the Trifluoroacetate Salt form and as a 0.1mg vial. Ghrelin is a peptide horone which plays a role in regulating energy balance, stimulating appetite, nutrient sensing and meal initiation. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>

Urotensin II-related peptide (URP) is a potent, selective, nonpeptide antagonist of the calcitonin gene-related peptide receptor. URP inhibits the binding of calcitonin gene-related peptide to its receptor and blocks the effects of this peptide on a variety of cell types. In addition, URP suppresses the release of substance P from sensory neurons in rat skin and blocks neurogenic inflammation. This product is purified by HPLC and has an analytical purity of >95%.

Azido-dPEG® 12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.

<p>Liver-Cell Growth Factor (LCGF) is a growth factor that stimulates the proliferation of liver cells. LCGF is found in coagulation factors, fatty acids, and peptides. LCGF has been shown to have long-term efficacy in the treatment of liver disease and has been demonstrated to be neuroprotective in animal models of Parkinson's disease. This growth factor also inhibits nucleotidase, which is an enzyme that breaks down nucleotides into mononucleotides and diphosphates. LCGF has been associated with statistically significant improvements in diameter and lysine levels in fetal bovine serum.</p>

<p>Salusin-Beta is a peptide that belongs to the group of activators. It has been shown to inhibit the activity of ion channels. Salusin-Beta (Human) is an antibody that can be used for research purposes. Salusin-Beta (Human) has been shown to have high purity and it can be used as a reagent for research and development in Cell Biology and Pharmacology.</p>

<p>A synthetic green mamba snake toxin sourced from the green mamba, Dendroaspis angusticeps, which can be used as a neuronal  L-type Ca2+ channel blocker. This product has disulfide bonds between Cys7-Cys57, Cys16-Cys40, and Cys32-Cys53 and is available as a 0.1mg vial.</p>

<p>MAL-dPEG®8-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®8-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Biotin-OSu is a biotin derivative that is used as a fluorescence probe for the detection of DNA binding activity. It has been shown to bind to DNA with high affinity in an experimental model. Biotin-OSu binds to the major groove of DNA and can be used to detect dna binding activities, such as protein-DNA interactions, by forming a ternary complex with the target protein and a fluorophore. This compound has also been shown to react with mouse monoclonal antibodies and human serum proteins, which are transfer reactions. Biotin-OSu has also been used as a coupling agent in peptide hormones and streptavidin polymerase chain reactions (PCR). The presence of disulfide bonds in this compound give it stability but limits its solubility.</p>

<p>Bis-dPEG®17-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>The SARS Spike peptide is a research tool that can be used as an activator and an antibody. It has a high purity and is contained in a CAS number. This peptide can be used for the study of protein interactions, receptor binding, ligand binding, and pharmacology.</p>

<p>Bis-dPEG®17-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>

<p>L-685,458 is a peptide that is used as a research tool to study protein interactions and the role of ion channels in cell biology. It binds to the receptor site and inhibits the binding of natural ligands. L-685,458 is an inhibitor of ion channels and acts by blocking the voltage-dependent activation of sodium channels. It also blocks potassium channels, which are responsible for regulating membrane potentials and controlling nerve impulses. L-685,458 has been shown to inhibit protein interactions in pharmacology studies with receptor binding assays.</p>

<p>Eledoisin is a novel ion channel activator that belongs to the group of peptides. It has been shown to activate voltage-gated sodium channels and calcium channels in cell culture, which may be due to its ability to inhibit the phosphorylation of L-type channels. Eledoisin also binds to human and rat receptors with high affinity, exhibiting a ligand binding affinity of IC50 = 0.5 nM. The amino acid sequence of eledoisin is related to that of other peptides such as beta-amyloid, calcitonin, bombesin, and thyrotropin releasing hormone (TRH).</p>

<p>Cl-Ac-(OH)Leu-Ala-Gly-NH2 is a peptide with an amino acid composition of Cl-Ac-(OH)Leu-Ala-Gly. It is synthesized by the chemical reaction of hydrochloric acid and L-alanine. This peptide has been shown to be an irreversible inhibitor of metalloendopeptidase, preventing the breakdown of proteins in the stomach. The pH profile for this peptide is acidic and its molecular weight is approximately 1296 daltons.</p>

<p>As a dynorphin peptide, Dynorphin A has affinity for opioid receptors in particular it favors kappa-opioid receptors and residues 1-13 of the Dynorphin A peptide are crucial for its potency. Kappa-opioid receptors are expressed in the brain, peripheral tissues and the spinal cord and are located in areas involved in pain. For example when Dynorphin A binds to kappa-opioid receptors, dopamine is inhibited in areas of the brain prevalent in drug addiction, thus demonstrated Dynorphin A to have antagonistic effects on the brain reward circuit. Dynorphin A could be a useful research tool for studying analgesia, reward and addiction.<br>This product is available as a 0.5mg vial.</p>

<p>Melanin-concentrating hormone (MCH) is a neuropeptide that is used to study the regulation of food intake and body weight. MCH binds to its receptor, the melanocortin-4 receptor (MC4R), which is coupled to an ion channel. This binding causes the release of potassium ions from cells, leading to depolarization and increased neuronal excitability. It has been shown that MCH can be used as a research tool for studying ion channels, ligand-receptor interactions, and cell biology.</p>

<p>Cbz-N-Amido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Cbz-N-Amido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is a fluorinated glycoside that is used as a reagent in organic synthesis to fluorinate alcohols and amines. It selectively reacts with primary and secondary alcohols to give the corresponding fluorides. The product can be used for the synthesis of carboxylic acids and esters. 2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is also used in biochemistry research as a substrate for oligosaccharide synthesis. This product has been shown to react with proteins to form peptides and with DNA to form nucleosides.

<p>Secretin (human) is a peptide hormone that is produced in the duodenum and is involved in the regulation of pancreatic bicarbonate, gastric acid and osmoregulation. Secretin binds to secretin receptors which are G-protein coupled receptors and are expressed in pancreatic centroacinar cells. Secretin binds to these receptors and activates adenylate cyclase which converts ATP into cAMP which results in the secretion of bicarbonate from the pancreas. Secretin plays a role in osmoregulation through its effects on the kidney, pituitary gland and the hypothalamus. This product is available as a 0.5mg vial.</p>

<p>A molluscan cardioexcitatory neuropeptide which has the potential to be used in cell biology, pharmacological, and protein-protein interaction studies. This product is available as an FMRF-Amide.</p>

<p>Somatostatin is a peptide hormone that has been found to inhibit pituitary growth hormone release as well as endocrine, pancreatic and GI secretions. It is widely expressed throughout the body for example in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma. This product contains disulfide bonds between Cys3-Cys14 and is available as a 0.5mg vial.</p>

<p>Angiotensin IV (Human) is a peptide hormone and peptidase inhibitor that belongs to the family of angiotensins. It is produced by the renin-angiotensin system and inhibits the action of angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. Angiotensin IV has been used for research purposes as well as for therapeutic applications in cardiovascular diseases, hypertension, and congestive heart failure. Angiotensin IV is a high purity product with a purity greater than 99%.</p>

<p>Ac-Val-Asp-Val-Ala-Asp-AMC is a research tool used to study the function of ion channels. It is an activator that binds to the receptor site on ATP sensitive potassium channels. Ac-Val-Asp-Val-Ala-Asp-AMC has been shown to inhibit calcium and sodium ion flux through ion channels, as well as high purity and good solubility. This peptide is useful for studying protein interactions, pharmacology, and life science research.</p>

<p>Ac-Gly-Lys-OMe • AcOH is a synthetic substrate that is used in enzymatic reactions. This product is a peptide that contains an amide bond and a disulfide bond. It has been shown to be inactive when exposed to human serum for up to 30 minutes. Ac-Gly-Lys-OMe • AcOH has been shown to have inhibitory effects on the activity of monoclonal antibodies as well as dodecyl, which belongs to the group of lipids found in blood plasma. The rate of this reaction increases with increasing temperature and pH, but decreases with increasing concentrations of AGLME or dodecanol.</p>

<p>Lipoamido-dPEG®8-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®8-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>

<p>Amyloid Beta-Protein (42-1) is a recombinant form of the protein, amyloid beta-protein, that is relevant to Alzheimer's disease. It is used as a research tool and for pharmacological studies. Amyloid Beta-Protein (42-1) has been shown to bind to ion channels and activate them. This product can be used as an antibody or cell biology research tool.</p>

<p>CoV-2 Spike (1000-1200) is a ProSpec that is used for the detection of Angiotensin Converting Enzyme 2 (ACE-2). The spike protein binds to ACE-2, which can be found in the human blood plasma. The CoV-2 Spike (1000-1200) can be used for the detection of coronavirus such as MERS-CoV and SARS-CoV. It can also be used to detect Proteins in samples such as COVID-19.</p>

<p>MOCA-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 is a synthetic peptide that interacts with the nicotinic acetylcholine receptor and is a potent agonist. MOCA was found to be a potent activator of the nicotinic acetylcholine receptor, as well as an inhibitor of ligand binding. The affinity for binding to the receptor was found to be high, with an inhibition constant (Ki) of 0.06 μM. It has been shown to inhibit ion channels and ligand binding in cell biology experiments. MOCA can also be used as a research tool for studying protein interactions and receptors.</p>

<p>SPDP-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>

<p>Azido-dPEG®4-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>