
Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30306 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Biotin-SARS-CoV-2 Spike RBD 395-430 peptide
<p>Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is the biotinylated version of SARS-CoV-2 Spike RBD 395-430 peptide. SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD). Biotin-SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies<br>SARS-CoV-2 Spike (S) glycoprotein<br>Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells.<br>With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane.<br>SARS-CoV-2 Spike RBD:<br>The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry.</p>NH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24
NH2-dPEG®4-Glu(OH)-NH-dPEG®4-Glu(OH)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.Fórmula:C81H157N5O40Pureza:Min. 95%Peso molecular:1,841.12 g/molGLP-1 (Human, Rat, Mouse)-EIA Kit (1ea)
<p>GLP-1 (Human, Rat, Mouse)-EIA Kit is a ready-to-use kit that contains a recombinant human GLP-1 peptide. This kit is designed for the quantitative measurement of GLP-1 in human serum or plasma by ELISA. It uses a polyclonal antibody to detect the protein and has no cross-reactivity with other pancreatic hormones. The assay can be used with rat and mouse samples as well.</p>Pureza:Min. 95%C-Peptide (Mouse)-EIA Kit (1ea)
<p>C-Peptide (Mouse)-EIA Kit is a mouse C-peptide EIA kit. It is designed for the quantitative measurement of C peptide in serum samples from mice. The kit contains an antibody that recognizes mouse C peptide, and a conjugate that binds to the antibody. The kit also contains a biotin-labeled anti-mouse IgG antibody, which reacts with the conjugate to form a complex that is subsequently detected by an enzyme-conjugated streptavidin. The amount of complex formed is proportional to the amount of C peptide present in the sample.</p>Pureza:Min. 95%Anti Substance P Serum
<p>Anti-Substance P Serum is a high purity protein that specifically binds to the receptor for substance P, which is a peptide hormone. This product has an affinity for the high affinity binding site of the receptor and inhibits the activity of substance P. Anti-Substance P Serum is used as a research tool in pharmacology and cell biology, as well as in antibody production.</p>Pureza:Min. 95%Amyloid Beta-Protein (Human, 1-16)
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is associated with Alzheimer's disease. It is a research tool for understanding the biology of Aβ. The Aβ peptide has been shown to activate a number of receptors and ion channels, including the nicotinic acetylcholine receptor, which may be due to its ability to bind to these proteins with high affinity. Amyloid beta-protein has also been shown to bind antibodies, which may be due to its ability to act as an antigen. Amyloid beta-protein inhibits the function of ion channels and can be used in pharmacological studies as a tool for understanding how this protein interacts with other proteins.</p>Fórmula:C84H119N27O28Pureza:Min. 95%Peso molecular:1,955 g/molAc-Asp-Glu • H2O
CAS:Ac-Asp-Glu • H2O is a water soluble molecule that belongs to the class of inhibitors. It has been shown to inhibit the polymerase chain reaction and is used as an analytical method for detecting DNA sequences. Ac-Asp-Glu • H2O induces neuronal death in the caudate putamen, thereby causing bowel disease, by inhibiting energy metabolism. This compound also inhibits the synthesis of proteins in the hippocampus, which leads to reduced locomotor activity and eosinophil cationic protein production. Ac-Asp-Glu • H2O is acidic and its concentration–time curve shows a bell shape. The half life of this compound is six hours.Fórmula:C11H16N2O8•H2OPureza:Min. 95%Peso molecular:322.28 g/molChromogranin A (Human, 286-301 Amide)
CAS:<p>Chromogranin A (Human, 286-301 Amide) is a protein that belongs to the class of peptides. It is a major component of the chromaffin granules in the adrenal medulla and in neuroendocrine cells in various parts of the brain. There are two types of chromogranin A, which have 286-301 amino acids. Chromogranin A is an activator for G-protein coupled receptors, ion channels, and ligands. This protein has been used as a research tool in Cell Biology and as an inhibitor in Pharmacology.</p>Fórmula:C78H123N21O27SPureza:Min. 95%Peso molecular:1,819 g/molAIP-I
CAS:<p>AIP-I is a peptide that is an activator of ion channels. The AIP-I peptide is a synthetic analog of the natural ligand, AIP-II. It has been shown to be a potent inhibitor of voltage-gated potassium channels in human embryonic kidney cells and has also been used as a research tool for studying protein interactions and receptor pharmacology.</p>Fórmula:C43H60N8O13S2Pureza:Min. 95%Peso molecular:961.12 g/molBNP-26 (Porcine)
CAS:<p>BNP-26 is a non-peptide, small molecule that regulates ion channels. It binds to the receptor site of ligand-gated ion channels and inhibits the binding of neurotransmitters to the receptor. BNP-26 is an inhibitor that blocks the activation of phospholipase C (PLC) and protein kinase C (PKC), which are enzymes that regulate cell proliferation, differentiation, and apoptosis. BNP-26 is also an antibody cross-linker with high purity and CAS No. 114547-28-3.</p>Fórmula:C120H198N42O36S2Pureza:Min. 95%Peso molecular:2,869.2 g/molAc-Val-Asp-Val-Ala-Asp-H (aldehyde)
CAS:Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) is a peptide that is a cell biology research tool. It is an inhibitor of protein interactions, activator, ligand or receptor. Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) has high purity and is suitable for life science research. Ac-Val-Asp-Val-Ala-Asp-H (aldehyde) can be used as an ion channel inhibitor in pharmacology studies. Ac Val Asp Val Ala Asp H (aldehyde) also functions as an antibody to a protein of interest.Fórmula:C23H37N5O10Pureza:Min. 95%Peso molecular:543.57 g/molBis-dPEG®25-Acid
CAS:<p>Bis-dPEG®25-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®25-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C54H106O29Pureza:Min. 95%Peso molecular:1,219.4 g/molAzido-dPEG® 11-amine
CAS:<p>Azido-dPEG® 11-amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 11-amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:570.67 g/molSar1, Ile4,8]-Angiotensin II
CAS:<p>Sar1, Ile4,8]-Angiotensin II is a peptide that belongs to the class of angiotensins. It has been shown to activate angiotensin receptors and is used as a research tool in pharmacology and cell biology. Sar1, Ile4,8]-Angiotensin II interacts with ligands such as heparin-binding EGF-like growth factor (HB-EGF) and angiopoietin 1 (ANGPT1). The antibody against Sar1, Ile4,8]-Angiotensin II blocks the receptor binding activity of this peptide. Sar1, Ile4,8]-Angiotensin II has been shown to be an inhibitor of ion channels such as inward rectifier potassium channels.</p>Fórmula:C43H75N13O9Pureza:Min. 95%Peso molecular:918.14 g/molAzido-dPEG®24-Alcohol
CAS:Azido-dPEG®24-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®24-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.Pureza:Min. 95%Peso molecular:1,100.29 g/molOxytocin (Human, Porcine, Bovine, Rat, Ovine)
CAS:<p>Oxytocin is a peptide hormone that is produced by the hypothalamus and released by the pituitary gland. It is used to induce labor, control postpartum bleeding and stimulate milk production. Oxytocin also plays a role in sexual arousal, social recognition, and trust. It has been shown to have an inhibitory effect on many types of ion channels, including those found in the heart, central nervous system, and blood vessels. Oxytocin binds to receptors that are found throughout the body and brain. The receptor for oxytocin is known as OXT. This receptor belongs to the G-protein coupled receptor family of receptors. Oxytocin was first isolated from sheep serum in 1906 by Henry Dale and Charles Robert Harington. It was later synthesized in 1953 by Vincent du Vigneaud. This product has disulfide bonds between Cys1-Cys6.</p>Fórmula:C43H66N12O12S2Pureza:Min. 95%Peso molecular:1,007.2 g/molFmoc-Phe-OH (Ring-D5)
CAS:<p>Fmoc-Phe-OH is a peptide that has been used as a research tool to study protein interactions. This molecule can be used in the inhibition of cellular processes and has been shown to activate the ATPase activity of Na,K-ATPase. Fmoc-Phe-OH is also a ligand that binds to receptors, such as the GABA receptor, through ion channels. This compound may also be used in antibody production or as an immunogen.</p>Fórmula:C24H26D5NOPureza:Min. 95%Peso molecular:392.48 g/molMAL-dPEG®12-NHS Ester
CAS:<p>MAL-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C32H52F4O14Pureza:Min. 95%Peso molecular:736.75 g/molCyclo(Arg-Gly-Asp-D-Phe-Val)
CAS:Cyclo(Arg-Gly-Asp-D-Phe-Val) is a peptide inhibitor of protein interactions. It binds to the ligand binding site of receptor and inhibits the activation of this receptor. Cyclo(Arg-Gly-Asp-D-Phe-Val) also binds to antibodies and can be used as a research tool for identifying antibody targets.Fórmula:C26H38N8O7•CH3COOH•2H2OPureza:Min. 95%Peso molecular:670.91 g/molα-Endorphin
CAS:An opioid peptide derived from the polypeptide pro-opiomelanocortin and binds to opioid receptors. It is involved in morphinomimetic behavior and physiologic activities. This product is available as a 0.5mg vial.Fórmula:C77H120N18O26SPureza:Min. 95%Peso molecular:1,745.9 g/molBis-dPEG®5-Acid
CAS:<p>Bis-dPEG®5-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®5-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C12H18O5SPureza:Min. 95%Peso molecular:274.33 g/molAngiotensin III (Human)
CAS:<p>Angiotensin III (Human) is a peptide that is an inhibitor of angiotensin-converting enzyme. It has been used in research to study protein interactions and receptor binding, as well as to isolate antibodies against this protein. The peptide is a high purity product with a CAS number of 13602-53-4.</p>Fórmula:C46H66N12O9Pureza:Min. 95%Peso molecular:931.09 g/mol4-Formyl-Benzamido-dPEG®24-TFP Ester
<p>4-Formyl-Benzamido-dPEG®24-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. 4-Formyl-Benzamido-dPEG®24-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C65H107F4NO28Pureza:Min. 95%Peso molecular:1,426.53 g/mol...Bis-ACV
CAS:<p>Bis-ACV is a synthetic compound that has the ability to act as a carbon source for filamentous fungi. It can also be used to regulate the expression of genes and enzymes in filamentous fungi. Bis-ACV has been shown to increase the production of cytosolic calcium, thereby stimulating enzyme activities in various organisms. It is an oligosaccharide with a molecular weight of 548 Daltons and contains two acetyl groups, which are attached to glucose residues on the same side of the molecule. The biological sample was purified by HPLC and the subunits were identified by mass spectrometry. The sequence analysis revealed that Bis-ACV is composed of repeating units that have the structure of N-acetylglucosamine linked via alpha (1->4) glycosidic bonds.</p>Pureza:Min. 95%Peso molecular:724.27 g/molω-Agatoxin TK
CAS:A synthetic spider toxin, sourced from the Funnel Web Spider, Agelenopsis aperta. This toxin can be applied as a P-type Ca2+ channel selective blocker and has disulfide bonds between Cys4-Cys20, Cys12-Cys25,Cys19-Cys36 and Cys27-Cys34. This product is available as a 0.1mg vial.Fórmula:C215H337N65O70S10Pureza:Min. 95%Peso molecular:5,273 g/molSARS Spike (306-515), Sf9
<p>SARS Coronavirus is an enveloped virus containing 3 outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein takes part in the virus infection cycle and is the primary target of neutralizing antibodies. SARS Spike produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 219 amino acids (306-515 aa) and having a molecular mass of 24.7kDa.SARS Spike is fused to a 6 amino acid His tag at C-terminus and purified by proprietary chromatographic techniques. The formulation of the SARS Spike (306-515) solution (0.5mg/ml) contains Phosphate-Buffered Saline (pH 7.4) and 10% Glycerol. Biological Activity: Measured by its binding ability in a functional ELISA with Human ACE-2 (CAT# enz-1159).<br>One-Letter Formula: ADPRVVPSGD VVRFPNITNL CPFGEVFNAT KFPSVYAWER KKISNCVADY SVLYNSTFFS TFKCYGVSAT KLNDLCFSNV YADSFVVKGD DVRQIAPGQT GVIADYNYKL PDDFMGCVLA WNTRNIDATS TGNYNYKYRY LRHGKLRPFE RDISNVPFSP DGKPCTPPAL NCYWPLNDYG FYTTTGIGYQ PYRVVVLSFE LLNAPATVCG PKLHHHHHH</p>Pureza:Min. 95%Fmoc-N-Amido-dPEG®6-Acid
CAS:<p>Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C30H41NO10Pureza:Min. 95%Peso molecular:575.65 g/molDiamido-dPEG®11-Diamine
CAS:<p>Diamido-dPEG®11-Diamine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Diamido-dPEG®11-Diamine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C31H49N3O13S2Pureza:Min. 95%Peso molecular:735.87 g/molMAL-dPEG®4-TFP Ester
CAS:<p>MAL-dPEG®4-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C42H59N5O11SPureza:Min. 95%Peso molecular:842.01 g/molMAL-dPEG®2-Acid
CAS:<p>MAL-dPEG®2-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®2-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C38H63N3O19Pureza:Min. 95%Peso molecular:865.92 g/mol[D-Ala2,Met5]-Enkephalinamide
CAS:<p>D-Ala2,Met5]-Enkephalinamide is a potent endogenous opioid peptide that binds to opioid receptors and has been shown to have both antinociceptive and depressant effects. It has been shown to be effective in a model system of pain, acting on the descending antinociceptive pathway from the rostral ventromedial medulla (RVM) to the spinal cord. D-Ala2,Met5]-Enkephalinamide has also been observed to inhibit locomotor activity in CD1 mice at sub-effective doses. D-Ala2,Met5]-Enkephalinamide has been shown to act through activation of both G protein-coupled mu opioids receptors and G protein-coupled delta opioid receptors.</p>Fórmula:C28H38N6O6S•CH3COOH•H2OPureza:Min. 95%Peso molecular:664.77 g/molLipoamido-dPEG®4-Acid
CAS:<p>Lipoamido-dPEG®4-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®4-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C59H115NO27S2Pureza:Min. 95%Peso molecular:1,334.66 g/molZ-Ala-Ala-Asn-AMC
CAS:<p>Z-Ala-Ala-Asn-AMC is a peptide that can be used as an inhibitor, activator, or ligand for protein interactions. It is also a research tool and antibody production reagent. This compound has high purity and is suitable for both in vitro and in vivo research.</p>Fórmula:C28H31N5O8Pureza:Min. 95%Peso molecular:565.57 g/mol2-NBDLG
CAS:<p>2-NBDLG is a potent activator of ion channels, which are membrane proteins that allow the passage of ions across biological membranes. It binds to receptor sites on the cell surface and opens ligand-gated ion channels in the plasma membrane, thereby increasing the permeability of the membrane to sodium ions. 2-NBDLG has been shown to inhibit voltage-gated potassium channels and calcium ion (Ca2+) currents in vitro. This drug also has an affinity for various peptides such as bradykinin and substance P. 2-NBDLG is a high purity product with a CAS number of 174844-42-9.</p>Fórmula:C12H14N4O8Pureza:Min. 95%Peso molecular:342.26 g/molCl-Ac-(OH)Leu-Ala-Gly-NH₂
CAS:<p>Cl-Ac-(OH)Leu-Ala-Gly-NH₂ is a peptide with a molecular weight of 736.2 Da. It is an inhibitor of the enzyme protein kinase C (PKC). Cl-Ac-(OH)Leu-Ala-Gly-NH₂ has been shown to activate PKC by binding to specific domains in the enzyme, which leads to the phosphorylation and activation of PKC's regulatory subunits. This peptide can be used as a research tool in studies involving PKC and also as an antibody carrier for Western blotting and immunohistochemistry.</p>Fórmula:C13H23N4O5ClPureza:Min. 95%Peso molecular:350.8 g/molBis-MAL-Lysine-dPEG®4-Acid
CAS:<p>Bis-MAL-Lysine-dPEG®4-Acid is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Fórmula:C20H28N2O12Pureza:Min. 95%Peso molecular:488.44 g/molt-boc-N-Amido-dPEG®8-Acid
CAS:<p>t-boc-N-Amido-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C34H64N6O13SPureza:Min. 95%Peso molecular:796.97 g/molGRF (Human)
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion. See also GRF (1-29); sermorelin, a shorter fragment. Sequence alignments: porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 95%Peso molecular:5,039.7 g/molAngiotensin II (Human)
CAS:<p>Angiotensin II (Human) is a peptide that is produced by the renin-angiotensin system. It has been shown to be an effective inhibitor of the cell adhesion molecule CD44, and can also stimulate the proliferation of cells in culture. Angiotensin II (Human) is a ligand for angiotensin receptors, which are found on many different types of cells. The binding of angiotensin II to these receptors stimulates the production of cyclic AMP, which causes vasoconstriction and increased blood pressure.</p>Fórmula:C50H71N13O12Pureza:Min. 95%Peso molecular:1,046.2 g/molGly-Pro-pNA • Tos [GPNT]
CAS:<p>Gly-Pro-pNA • Tos is a peptide that is derived from the sequence of the human beta2 adrenergic receptor. It can be used as a research tool for studying receptor-ligand interactions and for identifying ligands for other receptors. Gly-Pro-pNA • Tos may also be used as an inhibitor of ion channels.</p>Fórmula:C13H16N4O4•C7H8O3SPureza:Min. 95%Peso molecular:464.49 g/molFmoc-OSu
CAS:<p>Fmoc-OSu is a synthetic amino acid that is used in the synthesis of peptides and other biomolecules. It can be synthesized by solid-phase peptide synthesis using Fmoc chemistry, which involves an acid-labile protecting group. Fmoc-OSu has been shown to inhibit cancer cell growth, although its mechanism is not known.<br>Fmoc-OSu has been shown to have anti-inflammatory effects by inhibiting the proinflammatory cytokine TNFα.<br>Fmoc-OSu has also been shown to have glycan binding properties, which may be due to its ability to bind with sialic acid residues on glycoproteins or glycolipids.</p>Fórmula:C19H15NO5Pureza:Min. 98.0 Area-%Peso molecular:337.33 g/molAzido-dPEG®8-Alcohol
CAS:<p>Azido-dPEG®8-Alcohol is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, azido-dPEG®8-Alcohol is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Pureza:Min. 95%Peso molecular:395.45 g/molCCK-Octapeptide (26-33) (Non-Sulfated Form)
CAS:<p>CCK-Octapeptide (26-33) is a peptide that is a member of the cholecystokinin family of peptides. CCK-Octapeptide (26-33) is an activator of the CCK receptor and can be used for research purposes. This peptide has been shown to inhibit ion channels, which are proteins that regulate the flow of ions across cell membranes, and may be used as a pharmacological tool or research tool.</p>Fórmula:C49H62N10O13S2Pureza:Min. 95%Peso molecular:1,063.2 g/molBis-dPEG®7-NHS Ester
CAS:<p>Bis-dPEG®7-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®7-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C26H40N2O15Pureza:Min. 95%Peso molecular:620.6 g/molm-dPEG®24-Azide (Azido-m-dPEG®24)
CAS:<p>m-dPEG®24-Azide (Azido-m-dPEG®24) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Azide (Azido-m-dPEG®24) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C32H44F4N2O13Pureza:Min. 95%Peso molecular:740.69 g/molMAL-dPEG®24-Acid
CAS:<p>MAL-dPEG®24-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®24-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C58H108N2O29Pureza:Min. 95%Peso molecular:1,297.47 g/moldPEG®4 SATA (S-Acetyl-dPEG®4 NHS Ester)
CAS:dPEG®4 SATA (S-Acetyl-dPEG®4 NHS Ester) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®4 SATA (S-Acetyl-dPEG®4 NHS Ester) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C17H27NO9SPureza:Min. 95%Peso molecular:421.46 g/molFmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid)
CAS:<p>Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) is an ion channel activator with a molecular weight of 921.5 Da. It has been shown to activate the voltage-gated potassium channels Kv1.2 and Kv1.3 in rat cortical neurons, and inhibit the activity of the voltage-gated sodium channels Nav1.6, Nav1.7, and Nav1.8 in rat dorsal root ganglia neurons. In addition, Fmoc-N-Lys-(dPEG®4-Biotin)-OH-(Acid) has been shown to activate the calcium release activated calcium channels (CRACs) in human erythrocytes and induce the release of arachidonic acid from human platelets. It is a high purity reagent for research purposes only, not for use in humans or animals for any reason other than scientific research</p>Fórmula:C89H163F4NO39S2Pureza:Min. 95%Peso molecular:2,011.35 g/molm-dPEG®4-Azide (Azido-m-dPEG®4)
CAS:<p>m-dPEG®4-Azide (Azido-m-dPEG®4) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Azide (Azido-m-dPEG®4) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C72H145N3O36Pureza:Min. 95%Peso molecular:1,628.92 g/molAmyloid Beta-Protein (Human, 25-35)
CAS:<p>Amyloid beta-Protein (Human, 25-35) is the shortest amyloid fragment that forms β-sheet fibrils, while retaining toxicity, and may also induce the aggregation of N-tau protein and N-tau peptide 1/2R. Consequently this peptide may play a role in the pathogenesis of Alzheimer's disease, a neurodegenerative disorder that affects memory and cognitive function.<br>This product is available as a trifluoroacetate salt and as a 0.5mg vial.</p>Fórmula:C45H81N13O14SPureza:Min. 95%Peso molecular:1,060.3 g/molSARS CoV-2 IgG S1
<p>CoV-2 IgG S1 antibody binds to both SARS-CoV and SARS-CoV-2 (COVID-19) with high affinity at amino acids 318-510 in the S1 domain of the Spike protein and can be used in ELISA assays. SARS Coronavirus is an enveloped virus containing three outer structural proteins, namely the membrane (M), envelope (E), and spike (S) proteins. Spike (S)-glycoprotein of the virus interacts with a cellular receptor and mediates membrane fusion to allow viral entry into susceptible target cells. Accordingly, S-protein plays an important role in virus infection cycle and is the primary target of neutralizing antibodies. It has recently been shown that SARS is caused by a human coronavirus. Human coronaviruses are the major cause of upper respiratory tract illness in humans, such as the common cold. Coronaviruses are positive-stranded RNA viruses, featuring the largest viral RNA genomes known to date (27-31 kb). The first step in coronavirus infection is binding of the viral spike protein, a 139-kDa protein, to certain receptors on host cells. The spike protein is the main surface antigen of the coronavirus. The most prominent protein in the culture supernatants infected with SARS virus is a 46 kDa nucleocapsid protein. This suggests that the nucleocapsid protein is a major immunogen that may be useful for early diagnostics.<br>Recombinant Anti Human SARS CoV-2 IgG1 Kappa Spike S1 is a recombinant monoclonal antibody derived from HEL293 cells, which recognizes the SARS-CoV and SARS-CoV-2 Spike glycoprotein. CoV-2 IgG S1 Antibody binds to both SARS-CoV and SARS-CoV-2 with high affinity at amino acids 318-510 (RBD, Receptor Binding Domain) in the S1 subunit of the Spike protein. The native monoclonal antibody was generated by sequencing peripheral blood lymphocytes of a patient exposed to the SARS-CoV. The ELISA Plate was coated with the target proteins at 5 µg/ml. Primary antibodies were titrated on a 3-fold serial dilution starting at 125 ng/ml, CoV-2 IgG S1 antibody recognises SARS-CoV-2 spike protein subunit 1 (aa 1-674), or 41.6 ng/ml CoV-2 IgG S1 antibody recognised spike protein from SARS-CoV (subunit 1, aa 1-666) and SARS-CoV-2 (subunit 1, aa 1-674). Secondary antibody anti-human IgG conjugated to HRP used in the assay, at 1:4000 concentration. This product was purified through Protein A affinity and avaiable in the formulation: 1mg/ml in PBS and 0.02% Proclin 300F.</p>Pureza:Min. 95%NHS-m-dPEG® (MW = 509)
CAS:NHS-m-dPEG® (MW = 509) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-m-dPEG® (MW = 509) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:509.54 g/molBoc-Phe-Ser-Arg-AMC
CAS:<p>Boc-Phe-Ser-Arg-AMC is a peptide that can be used as a research tool in the study of protein interactions, receptor activation and ligand binding. It is an inhibitor of ion channels and has been shown to be an antagonist of nicotinic acetylcholine receptors. This product may be used as a research tool for studying cell biology, pharmacology, and life sciences.</p>Fórmula:C33H43N7O8Pureza:Min. 95%Peso molecular:665.74 g/molSomatostatin
CAS:<p>Somatostatin is a peptide hormone that is produced by the hypothalamus and inhibits the release of growth hormones, stimulates the release of insulin from the pancreas, and inhibits the release of glucagon from the pancreas. Somatostatin also has biological properties that inhibit neuronal death in combination therapy groups. It has been shown to have cell factor activity which may contribute to its antitumor activity. Somatostatin also has pro-apoptotic properties in vitro assays at physiological levels, making it an excellent target for cancer therapy.</p>Fórmula:C76H104N18O19S2Pureza:Min. 95%Peso molecular:1,637.9 g/molBiotin-dPEG®3-MAL
CAS:<p>Biotin-dPEG®3-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Biotin-dPEG®3-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C15H32N2O5Pureza:Min. 95%Peso molecular:320.43 g/molMAL-dPEG®4-Acid
CAS:<p>MAL-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:416.42 g/molt-Boc-N-Amido-dPEG®3-Amine
CAS:<p>t-Boc-N-Amido-dPEG®3-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-Boc-N-Amido-dPEG®3-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:320.43 g/molSuc-Gly-Pro-Leu-Gly-Pro-AMC
CAS:<p>Suc-Gly-Pro-Leu-Gly-Pro-AMC is a high purity, monoclonal antibody that can be used as a research tool or as an inhibitor. It has been shown to inhibit ion channels and protein interactions. Suc-Gly-Pro-Leu-Gly-Pro-AMC is also known as a ligand for the receptor. It has been shown to activate the receptor and cause a change in the cell membrane permeability by increasing calcium flux, which leads to an increase in intracellular calcium levels. Suc-Gly-Pro-Leu-Gly-Pro-AMC is found in Cell Biology and Pharmacology research studies.</p>Fórmula:C34H44N6O10Pureza:Min. 95%Peso molecular:696.75 g/molMAL-dPEG®4- NHS Ester
CAS:<p>MAL-dPEG®4- NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4- NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:513.5 g/molAzido-dPEG®8-NHS ester
CAS:Azido-dPEG®Sub>8-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®Sub>8-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C23H40N4O12Pureza:Min. 95%Peso molecular:564.58 g/molß-Casomorphin-5 (Bovine)
CAS:<p>Beta-casomorphin-5 (BCM-5) is a peptide that is released from the digestion of casein in milk. It is an analog of casomorphin-7, which has been shown to have opioid activity. BCM-5 has been found to inhibit the proliferation of cells and induce apoptosis by binding to P21, a protein that controls the cell cycle. BCM-5 also binds to the mu-opioid receptor and inhibits gastric acid secretion. The conformational properties of BCM-5 have been determined with analytical methods such as LC/MS/MS, NMR, and FTIR. These studies have shown that BCM-5 adopts a ß-sheet conformation when bound to mucin glycoprotein or other proteins.</p>Fórmula:C30H37N5O7•2H2OPureza:Min. 95%Peso molecular:615.67 g/molSer-Gln-Asn-Tyr-Pro-Ile-Val
CAS:<p>Ser-Gln-Asn-Tyr-Pro-Ile-Val is a synthetic peptide. It has been shown to act as a competitive inhibitor of the GABA receptor, specifically in the alpha3 subunit. This inhibition has been found to be competitive with respect to GABA and benzodiazepine binding. Additionally, Ser-Gln-Asn-Tyr-Pro-Ile-Val has been shown to inhibit ion channels that are activated by extracellular potassium ions, such as KV7.1 and KV7.2 potassium channels.</p>Fórmula:C37H57N9O12Pureza:Min. 95%Peso molecular:819.9 g/molNPY (Porcine, Bovine)
CAS:<p>NPY is a peptide that belongs to the family of neuropeptides. It is an endogenous regulator of appetite and energy expenditure in the central nervous system, which has been shown to act as a neurotransmitter and neuromodulator. NPY is also an activator of ion channels, such as potassium channels, sodium channels, and calcium channels. NPY has been shown to bind with high affinity to receptors in the brain, heart, lungs, kidneys, and intestines. The binding of NPY to its receptor leads to activation of protein interactions. This process can lead to changes in cell physiology or regulation of physiological functions by altering gene expression or changing the concentration of ions in the blood. NPY has also been shown as an inhibitor for many different ligands and receptors including dopamine D1 receptors and serotonin 5-HT2A/C receptors.</p>Fórmula:C190H287N55O57Pureza:Min. 95%Peso molecular:4,253.6 g/molMOCAc-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-NH₂
<p>MOCAc-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-NH₂ is a protein inhibitor with a molecular weight of 1405.8 g/mol. It has a CAS number of 129857-88-6 and is available at high purity. MOCAc-Tyr-Val-Ala-Asp-Ala-Pro-Lys(Dnp)-NH₂ is used in research as an inhibitor, activator, or ligand for proteins. This product has been used in the study of ion channels, receptor binding, and cell biology.</p>Fórmula:C53H65N11O18Pureza:Min. 95%Peso molecular:1,144.1 g/molMSH-Release Inhibiting Factor
CAS:<p>MSH-Release Inhibiting Factor (MRIF) has been shown to be a potent inhibitor of the release of proinflammatory cytokines. It is derived from the acid methyl ester of mouse serum, and has been shown to inhibit the release of tumor necrosis factor-α (TNF-α) in animal studies. MRIF has also been shown to have anti-diabetic effects in mice. MRIF inhibits the production of inflammatory cytokines by blocking TNF-α at a molecular level. This protein binds to progesterone receptor and prevents it from interacting with its ligand, which is necessary for cancer cell growth. The expression system for this protein is E. coli, and it can be used as an immunosuppressant in animal studies.<br>MRIF also blocks TNF-α activity by inhibiting transcriptional activation of NFκB and AP-1, which are proteins that regulate gene expression.</p>Fórmula:C13H24N4O3H2OPureza:Min. 95%Peso molecular:293.36 g/molMethionine-Enkephalin (Human, Porcine, Bovine, Rat, Mouse)
CAS:Methionine-Enkephalin is a peptide that is derived from the amino acid methionine. It has been shown to act on ion channels and the receptor, as well as having a number of other biological effects. Methionine-Enkephalin can be used in research for pharmacology and protein interactions. This product is an antibody against methionine-enkephalin. It can be used for cell biology and immunology research, as it recognizes the peptide sequence of methionine-enkephalin. This antibody can also be used to inhibit the activity of this peptide.Fórmula:C27H35N5O7SPureza:Min. 95%Peso molecular:573.66 g/molm-dPEG®8-MAL
CAS:m-dPEG®8-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®8-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C56H111NO28Pureza:Min. 95%Peso molecular:1,246.47 g/molCoV-2 S1 (1-681)
A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV was found in the fish market at the city of Wuhan, Hubei province of China on December 2019.The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2) in humans.While bats are probably the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The HEK293-derived recombinant protein contains the Coronavirus 2019-nCoV Spike Glycoprotein S1, Wuhan-Hu-1 strain, amino acids 1-681 fused to Fc tag at C-terminal having a M.W. of 76 kDa. PNTA Sepharose-Affinity Purification was used to purify the product which is avaiable as the formulation: CoV-2 S1 protein solution is supplied PBS pH 7.4.Pureza:Min. 95%PACAP27 (Human, 1-27 Amide)
CAS:<p>PACAP27 is a peptide that is used as a research tool. PACAP27 binds to the receptor for pituitary adenylate cyclase-activating polypeptide (PACAP). The binding of PACAP27 to the receptor leads to activation of adenylyl cyclase, which increases intracellular levels of cAMP. This increase in cAMP may lead to cellular responses such as increased ion channel activity and increased protein synthesis.</p>Fórmula:C142H224N40O39SPureza:Min. 95%Peso molecular:3,147.6 g/molAdrenomedullin (Human)
CAS:<p>Adrenomedullin (human) is a research tool that has been shown to activate the ligand receptor. It is a member of the vasoactive peptide family, which includes adrenalin and noradrenaline. Adrenomedullin binds to the cell surface receptors on smooth muscle cells and endothelial cells and activates ion channels. This research tool is also known as AM.</p>Fórmula:C264H406N80O77S3Pureza:Min. 95%Peso molecular:6,028.7 g/molm-dPEG®4-MAL
CAS:<p>m-dPEG®4-MAL is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-MAL is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C32H63NO61Pureza:Min. 95%Peso molecular:717.84 g/molNeuroendocrine Regulatory Peptide-1 (Human)
CAS:This Neuroendocrine Regulatory Peptide-1 (human) product can be used as an endogenous suppressor of vasopressin release and is available as a 0.1mg vial. The neuroendocrine regulatory peptide-1 (NERP1) is derived from VGF and it colocalizes with vasopressin in the hypothalamus and it has been found that NERPs prevent vasopressin release from the hypothalamus. Thus NERP1 is involved in body fluid homeostasis through modulating the release of vasopressin.Fórmula:C113H192N36O39Pureza:Min. 95%Peso molecular:2,679 g/molThiol-dPEG®8-Acid
CAS:<p>Thiol-dPEG®8-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Thiol-dPEG®8-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:322.39 g/molAmino-dPEG®4-t-Butyl Ester
CAS:<p>Amino-dPEG®4-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®4-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C22H42O13Pureza:Min. 95%Peso molecular:514.56 g/molAPETx2
CAS:<p>APETx2 is a peptide that belongs to the inhibitor class of protein interactions. It has been shown to inhibit the activation of beta-adrenergic receptors by preventing the binding of the ligand, which is a catecholamine. APETx2 also has been shown to be an activator for muscarinic acetylcholine receptors. This peptide is a high purity research tool that can be used as an antibody conjugate in immunohistochemical and immunoprecipitation assays.</p>Fórmula:C196H280N54O61S6Pureza:Min. 95%Peso molecular:4,561 g/molt-boc-N-Amido-dPEG®12-Acid
CAS:<p>t-boc-N-Amido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-N-Amido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C65H119N5O28SPureza:Min. 95%Peso molecular:1,450.72 g/molBeta-Sheet Breaker Peptide iAß5
CAS:<p>Beta-Sheet Breaker Peptide iAß5 is a peptide that interacts with amyloid beta proteins to disrupt the formation of beta sheets. It has been shown to inhibit the aggregation of amyloid beta proteins into oligomers and fibrils, and disrupts the self-assembly of amyloid beta protein into various conformations. Beta-Sheet Breaker Peptide iAß5 is a ligand for both receptor and activator binding sites on amyloid beta proteins, inhibiting the interaction of these sites. This inhibits the activation of downstream signalling pathways associated with Alzheimer's disease.</p>Fórmula:C33H43N5O8Pureza:Min. 95%Peso molecular:637.72 g/molAzido-dPEG®4-Acid
CAS:<p>Azido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C11H21N3O6Pureza:Min. 95%Peso molecular:291.3 g/molPoly-L-lysine hydrochloride
CAS:<p>Poly-L-Lysine Hydrochloride is a synthetic polymer that has been shown to inhibit the growth of cancer cells. It has also been shown to be effective in preventing neuronal cell death, as well as toxicity caused by exposure to high levels of water vapor. Poly-L-Lysine Hydrochloride can be used as an anticancer agent and has a synergistic effect with other drugs. This polymer is thought to work by blocking the synthesis of DNA, RNA, and proteins, which are vital for the cell's survival.</p>Fórmula:(C6H14N2O2•HCl)xPureza:Min. 95%Hydroxy-dPEG®6-t-Butyl Ester
CAS:<p>Hydroxy-dPEG®6-t-Butyl Ester is a PEG polymer categorised as monofunctional (OH-PEG-X). Used as a linker, hydroxy-dPEG®6-t-Butyl Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C18H24N2O11Pureza:Min. 95%Peso molecular:444.39 g/molAminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3
CAS:<p>Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Aminooxy-dPEG®12-amido-dPEG®12-(m-dPEG®11)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C19H37N3O10Pureza:Min. 95%Peso molecular:467.51 g/mol[Val5]-Angiotensin I (Bovine) (Bulk)
CAS:<p>Angiotensin I (Bovine) is a synthetic substrate that is used for the measurement of Angiotensin I-converting enzyme activity in vitro. It has been incubated with rat or bovine tissue and can be used as a chromatographic standard. This substrate binds to the active site of the enzyme and undergoes hydrolysis, which generates an increase in pH. The resulting product is then measured fluorimetrically by measuring the decrease in absorbance at 350 nm. This peptide has been found to have a pressor effect and an inhibitory effect on acid secretion.</p>Fórmula:C61H87N17O14•CH3COOH•5H2OPureza:Min. 95%Peso molecular:1,432.53 g/molDes-Acyl Ghrelin (Human)
CAS:<p>Des-Acyl Ghrelin (Human) is a Des-Octanoylated Ghrelin product available in the Trifluoroacetate Salt form and as a 0.1mg vial. Ghrelin is a peptide horone which plays a role in regulating energy balance, stimulating appetite, nutrient sensing and meal initiation. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>Fórmula:C141H235N47O41Pureza:Min. 95%Peso molecular:3,244.7 g/molUrotensin II-Related Peptide (Human, Rat)
CAS:Urotensin II-related peptide (URP) is a potent, selective, nonpeptide antagonist of the calcitonin gene-related peptide receptor. URP inhibits the binding of calcitonin gene-related peptide to its receptor and blocks the effects of this peptide on a variety of cell types. In addition, URP suppresses the release of substance P from sensory neurons in rat skin and blocks neurogenic inflammation. This product is purified by HPLC and has an analytical purity of >95%.Fórmula:C49H64N10O10S2Pureza:Min. 95%Peso molecular:1,017.2 g/molAzido-dPEG® 12-NHS ester
CAS:Azido-dPEG® 12-NHS ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG® 12-NHS ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Pureza:Min. 95%Peso molecular:740.79 g/molLiver-Cell Growth Factor
CAS:Producto controlado<p>Liver-Cell Growth Factor (LCGF) is a growth factor that stimulates the proliferation of liver cells. LCGF is found in coagulation factors, fatty acids, and peptides. LCGF has been shown to have long-term efficacy in the treatment of liver disease and has been demonstrated to be neuroprotective in animal models of Parkinson's disease. This growth factor also inhibits nucleotidase, which is an enzyme that breaks down nucleotides into mononucleotides and diphosphates. LCGF has been associated with statistically significant improvements in diameter and lysine levels in fetal bovine serum.</p>Fórmula:C14H24N6O4•CH3COOH•H2OPureza:Min. 95%Peso molecular:418.45 g/molSalusin-Beta (Human)
CAS:<p>Salusin-Beta is a peptide that belongs to the group of activators. It has been shown to inhibit the activity of ion channels. Salusin-Beta (Human) is an antibody that can be used for research purposes. Salusin-Beta (Human) has been shown to have high purity and it can be used as a reagent for research and development in Cell Biology and Pharmacology.</p>Fórmula:C115H176N32O21Pureza:Min. 95%Peso molecular:2,342.8 g/molCalcicludine
CAS:<p>A synthetic green mamba snake toxin sourced from the green mamba, Dendroaspis angusticeps, which can be used as a neuronal L-type Ca2+ channel blocker. This product has disulfide bonds between Cys7-Cys57, Cys16-Cys40, and Cys32-Cys53 and is available as a 0.1mg vial.</p>Fórmula:C321H476N86O78S6Pureza:Min. 95%Peso molecular:6,980.1 g/molMAL-dPEG®8-NHS Ester
CAS:<p>MAL-dPEG®8-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®8-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C21H40O11SPureza:Min. 95%Peso molecular:500.6 g/molBiotin-OSu
CAS:<p>Biotin-OSu is a biotin derivative that is used as a fluorescence probe for the detection of DNA binding activity. It has been shown to bind to DNA with high affinity in an experimental model. Biotin-OSu binds to the major groove of DNA and can be used to detect dna binding activities, such as protein-DNA interactions, by forming a ternary complex with the target protein and a fluorophore. This compound has also been shown to react with mouse monoclonal antibodies and human serum proteins, which are transfer reactions. Biotin-OSu has also been used as a coupling agent in peptide hormones and streptavidin polymerase chain reactions (PCR). The presence of disulfide bonds in this compound give it stability but limits its solubility.</p>Fórmula:C14H19N3O5SPureza:Min. 95%Peso molecular:341.39 g/molBis-dPEG®17-NHS Ester
CAS:<p>Bis-dPEG®17-NHS Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-NHS Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C46H80N2O25Pureza:Min. 95%Peso molecular:1,061.13 g/molSARS Spike (408-470, 540-573)
<p>The SARS Spike peptide is a research tool that can be used as an activator and an antibody. It has a high purity and is contained in a CAS number. This peptide can be used for the study of protein interactions, receptor binding, ligand binding, and pharmacology.</p>Pureza:Min. 95%Bis-dPEG®17-PFP Ester
CAS:<p>Bis-dPEG®17-PFP Ester is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®17-PFP Ester is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C50H72F10O21Pureza:Min. 95%Peso molecular:1,199.08 g/molL-685,458
CAS:<p>L-685,458 is a peptide that is used as a research tool to study protein interactions and the role of ion channels in cell biology. It binds to the receptor site and inhibits the binding of natural ligands. L-685,458 is an inhibitor of ion channels and acts by blocking the voltage-dependent activation of sodium channels. It also blocks potassium channels, which are responsible for regulating membrane potentials and controlling nerve impulses. L-685,458 has been shown to inhibit protein interactions in pharmacology studies with receptor binding assays.</p>Fórmula:C39H52N4O6Pureza:Min. 95%Peso molecular:672.85 g/molEledoisin Related Peptide
CAS:<p>Eledoisin is a novel ion channel activator that belongs to the group of peptides. It has been shown to activate voltage-gated sodium channels and calcium channels in cell culture, which may be due to its ability to inhibit the phosphorylation of L-type channels. Eledoisin also binds to human and rat receptors with high affinity, exhibiting a ligand binding affinity of IC50 = 0.5 nM. The amino acid sequence of eledoisin is related to that of other peptides such as beta-amyloid, calcitonin, bombesin, and thyrotropin releasing hormone (TRH).</p>Fórmula:C34H58N8O6SPureza:Min. 95%Peso molecular:706.94 g/molCl-Ac-(OH)Leu-Ala-Gly-NH2
CAS:<p>Cl-Ac-(OH)Leu-Ala-Gly-NH2 is a peptide with an amino acid composition of Cl-Ac-(OH)Leu-Ala-Gly. It is synthesized by the chemical reaction of hydrochloric acid and L-alanine. This peptide has been shown to be an irreversible inhibitor of metalloendopeptidase, preventing the breakdown of proteins in the stomach. The pH profile for this peptide is acidic and its molecular weight is approximately 1296 daltons.</p>Fórmula:C13H23N4O5ClPureza:Min. 95%Peso molecular:350.8 g/molDynorphin A (Human, 1-13)
CAS:<p>As a dynorphin peptide, Dynorphin A has affinity for opioid receptors in particular it favors kappa-opioid receptors and residues 1-13 of the Dynorphin A peptide are crucial for its potency. Kappa-opioid receptors are expressed in the brain, peripheral tissues and the spinal cord and are located in areas involved in pain. For example when Dynorphin A binds to kappa-opioid receptors, dopamine is inhibited in areas of the brain prevalent in drug addiction, thus demonstrated Dynorphin A to have antagonistic effects on the brain reward circuit. Dynorphin A could be a useful research tool for studying analgesia, reward and addiction.<br>This product is available as a 0.5mg vial.</p>Fórmula:C75H126N24O15Pureza:Min. 95%Peso molecular:1,604 g/molMelanin-Concentrating Hormone (Human)
CAS:<p>Melanin-concentrating hormone (MCH) is a neuropeptide that is used to study the regulation of food intake and body weight. MCH binds to its receptor, the melanocortin-4 receptor (MC4R), which is coupled to an ion channel. This binding causes the release of potassium ions from cells, leading to depolarization and increased neuronal excitability. It has been shown that MCH can be used as a research tool for studying ion channels, ligand-receptor interactions, and cell biology.</p>Fórmula:C105H160N30O26S4Pureza:Min. 95%Peso molecular:2,386.8 g/molCbz-N-Amido-dPEG®4-Acid
CAS:<p>Cbz-N-Amido-dPEG®4-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Cbz-N-Amido-dPEG®4-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:399.44 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Mannopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is a fluorinated glycoside that is used as a reagent in organic synthesis to fluorinate alcohols and amines. It selectively reacts with primary and secondary alcohols to give the corresponding fluorides. The product can be used for the synthesis of carboxylic acids and esters. 2,3,4,6-Tetra-O-acetyl-α-D-mannopyranosyl fluoride is also used in biochemistry research as a substrate for oligosaccharide synthesis. This product has been shown to react with proteins to form peptides and with DNA to form nucleosides.Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molSecretin (Human)
CAS:<p>Secretin (human) is a peptide hormone that is produced in the duodenum and is involved in the regulation of pancreatic bicarbonate, gastric acid and osmoregulation. Secretin binds to secretin receptors which are G-protein coupled receptors and are expressed in pancreatic centroacinar cells. Secretin binds to these receptors and activates adenylate cyclase which converts ATP into cAMP which results in the secretion of bicarbonate from the pancreas. Secretin plays a role in osmoregulation through its effects on the kidney, pituitary gland and the hypothalamus. This product is available as a 0.5mg vial.</p>Fórmula:C130H220N44O40Pureza:Min. 95%Peso molecular:3,039.4 g/molFMRF-Amide
CAS:<p>A molluscan cardioexcitatory neuropeptide which has the potential to be used in cell biology, pharmacological, and protein-protein interaction studies. This product is available as an FMRF-Amide.</p>Fórmula:C29H42N8O4SPureza:Min. 95%Peso molecular:598.76 g/molSomatostatin (Human, Ovine, Porcine, Rat, Mouse)
CAS:<p>Somatostatin is a peptide hormone that has been found to inhibit pituitary growth hormone release as well as endocrine, pancreatic and GI secretions. It is widely expressed throughout the body for example in the gastrointestinal (GI) tract, hypothalamus, pancreas and the central nervous system. In the central nervous system somatostatin plays a role in neurotransmission modification and it has also demonstrated to be effective against a number of cancers such as squamous carcinoma. This product contains disulfide bonds between Cys3-Cys14 and is available as a 0.5mg vial.</p>Fórmula:C76H10N18O19S2Pureza:Min. 95%Peso molecular:1,637.9 g/molAngiotensin IV acetate
CAS:<p>Angiotensin IV (Human) is a peptide hormone and peptidase inhibitor that belongs to the family of angiotensins. It is produced by the renin-angiotensin system and inhibits the action of angiotensin converting enzyme, an enzyme that converts angiotensin I into angiotensin II. Angiotensin IV has been used for research purposes as well as for therapeutic applications in cardiovascular diseases, hypertension, and congestive heart failure. Angiotensin IV is a high purity product with a purity greater than 99%.</p>Fórmula:C40H54N8O8Pureza:Min. 95%Peso molecular:774.91 g/molAc-Val-Asp-Val-Ala-Asp-AMC
CAS:Producto controlado<p>Ac-Val-Asp-Val-Ala-Asp-AMC is a research tool used to study the function of ion channels. It is an activator that binds to the receptor site on ATP sensitive potassium channels. Ac-Val-Asp-Val-Ala-Asp-AMC has been shown to inhibit calcium and sodium ion flux through ion channels, as well as high purity and good solubility. This peptide is useful for studying protein interactions, pharmacology, and life science research.</p>Fórmula:C33H44N6O12Pureza:Min. 95%Peso molecular:716.74 g/molAc-Gly-Lys-OMe • AcOH [AGLME]
CAS:<p>Ac-Gly-Lys-OMe • AcOH is a synthetic substrate that is used in enzymatic reactions. This product is a peptide that contains an amide bond and a disulfide bond. It has been shown to be inactive when exposed to human serum for up to 30 minutes. Ac-Gly-Lys-OMe • AcOH has been shown to have inhibitory effects on the activity of monoclonal antibodies as well as dodecyl, which belongs to the group of lipids found in blood plasma. The rate of this reaction increases with increasing temperature and pH, but decreases with increasing concentrations of AGLME or dodecanol.</p>Fórmula:C11H21N3O4•CH3COOHPureza:Min. 95%Peso molecular:319.35 g/molLipoamido-dPEG®8-Acid
CAS:<p>Lipoamido-dPEG®8-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®8-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C41H67F4NO15S2Pureza:Min. 95%Peso molecular:954.09 g/molAmyloid Beta-Protein (42-1)
CAS:<p>Amyloid Beta-Protein (42-1) is a recombinant form of the protein, amyloid beta-protein, that is relevant to Alzheimer's disease. It is used as a research tool and for pharmacological studies. Amyloid Beta-Protein (42-1) has been shown to bind to ion channels and activate them. This product can be used as an antibody or cell biology research tool.</p>Fórmula:C203H311N55O60SPureza:Min. 95%Peso molecular:4,514 g/molCoV-2 Spike (1000-1200)
<p>CoV-2 Spike (1000-1200) is a ProSpec that is used for the detection of Angiotensin Converting Enzyme 2 (ACE-2). The spike protein binds to ACE-2, which can be found in the human blood plasma. The CoV-2 Spike (1000-1200) can be used for the detection of coronavirus such as MERS-CoV and SARS-CoV. It can also be used to detect Proteins in samples such as COVID-19.</p>Pureza:Min. 95%MOCAc-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH₂
CAS:<p>MOCA-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 is a synthetic peptide that interacts with the nicotinic acetylcholine receptor and is a potent agonist. MOCA was found to be a potent activator of the nicotinic acetylcholine receptor, as well as an inhibitor of ligand binding. The affinity for binding to the receptor was found to be high, with an inhibition constant (Ki) of 0.06 μM. It has been shown to inhibit ion channels and ligand binding in cell biology experiments. MOCA can also be used as a research tool for studying protein interactions and receptors.</p>Fórmula:C78H110N22O20Pureza:Min. 95%Peso molecular:1,675.8 g/molSPDP-dPEG®12-NHS Ester
CAS:<p>SPDP-dPEG®12-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. SPDP-dPEG®12-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C33H57N3O18Pureza:Min. 95%Peso molecular:783.82 g/molAzido-dPEG®4-acid
CAS:<p>Azido-dPEG®4-acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®4-acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C51H101N3O26Pureza:Min. 95%Peso molecular:1,172.35 g/molBoc-Gln-Arg-Arg-AMC
CAS:<p>Boc-Gln-Arg-Arg-AMC is a Research Tool that is used to study the interactions of protein ligands with receptor and ion channels. It has been shown to inhibit the activity of ion channels, such as calcium and potassium channels.</p>Fórmula:C32H49N11O8Pureza:Min. 95%Peso molecular:715.8 g/molBradykinin-Potentiator C
CAS:<p>Bradykinin-Potentiator C is a peptide that can act as an activator or inhibitor of ion channels. It has been used in research for pharmacology, protein interactions, cell biology, and antibody production. Bradykinin-Potentiator C is purified from rabbit lung and has a CAS number of 30953-20-9.</p>Fórmula:C51H77N11O13Pureza:Min. 95%Peso molecular:1,052.2 g/molVirus Replication Inhibiting Peptide
CAS:<p>The virus replication-inhibiting peptide is a fatty acid that inhibits the replication of viruses. It has been shown to inhibit the growth of the bacteria Stenotrophomonas maltophilia and other bacteria, which causes infectious diseases. The peptide also has a diagnostic use for detecting viral infections in cells. The peptide was found to up-regulate genes in response to infection by pandemic influenza, which may be due to its ability to bind receptors on cells and also interfere with inflammatory responses. The virus replication-inhibiting peptide has been shown to be effective against influenza virus and other viruses, as well as against chronic inflammatory diseases such as lung damage caused by β-amino acids.</p>Fórmula:C28H29N3O6Pureza:Min. 95%Peso molecular:503.55 g/molBis-MAL-dPEG®11
CAS:<p>Bis-MAL-dPEG®11 is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-MAL-dPEG®11 is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C65H105F4N9O21S2Pureza:Min. 95%Peso molecular:1,488.7 g/molBoc-Gln-Pro
CAS:<p>Boc-Gln-Pro is a peptide that can be used as a substrate for peptidoglutaminase.</p>Fórmula:C15H25N3O6Pureza:Min. 95%Peso molecular:343.38 g/molGRF (Human)
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C215H358N72O66SPureza:Min. 95%Peso molecular:5,039.7 g/molFmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH
CAS:Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH is a peptide that belongs to the group of carbohydrate derivatives. It has been shown to inhibit the growth of bacteria and fungi by inhibiting protein synthesis. The amino acid sequence is Ser-Gly-Gly-Gly-Ala-Ser, which has a high affinity for bacterial cell walls. Fmoc-Ser[Ac4Galß(1- >3)Ac2GalNAcα(1- >O)]-OH binds to bacterial cell walls by competitive inhibition of the enzyme D, L aminopimelate aminotransferase (EC 2.6.1.19). This binding prevents the formation of an antibiotic inhibitor complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division.Fórmula:C44H52N2O21Pureza:Min. 95%Peso molecular:944.88 g/molCGRP (Human)
CAS:<p>CGRP (calcitonin gene-related peptide) is a 37-amino acid neuropeptide that is found in humans and is widely distributed in the nervous system, particularly in sensory neurons, and is involved in the regulation of vascular tone, blood flow, pain perception, and inflammation. It is a potent vasodilator and has been implicated in the pathophysiology of several vascular disorders, including migraine headaches, cluster headaches, and hypertension.<br>In addition to its vascular effects, human CGRP also has neuroprotective properties and has been investigated as a potential therapeutic agent for various neurological disorders, such as Alzheimer's disease and Parkinson's disease.<br>Human CGRP has been extensively studied as a research tool to investigate its physiological and pathological roles in various tissues and diseases. It has also been targeted by pharmacological agents, such as CGRP antagonists and antibodies, for the treatment of migraine headaches and other conditions associated with CGRP dysfunction.<br>This product is available as a 0.5mg vial.</p>Fórmula:C163H267N51O49S2Pureza:Min. 95%Peso molecular:3,789.3 g/molMAL-dPEG®4-(m-dPEG®12)3
CAS:MAL-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Fórmula:C84H158N6O40Pureza:Min. 95%Peso molecular:1,892.17 g/molTuftsin
CAS:Producto controlado<p>Tuftsin is a cyclic peptide that has been shown to have various biological properties, including anti-inflammatory and immunosuppressive activity. Tuftsin has been shown to inhibit the production of proinflammatory cytokines such as IL-10 by T cells in vitro. Tuftsin also inhibits the activation of toll-like receptors (TLR) and may have a role in inhibiting mycobacterial infection. This drug was found to be well tolerated in humans with congestive heart failure, and is currently being evaluated for its potential use as an adjunct therapy for inflammatory bowel disease. It has also been shown to be effective against opportunistic fungal infections, such as Candida albicans, Cryptococcus neoformans, and Aspergillus fumigatus. Tuftsin can be measured using analytical methods such as titration calorimetry or polymerase chain reaction (PCR).</p>Fórmula:C21H40N8O6•2CH3COOH•4H2OPureza:Min. 95%Peso molecular:692.75 g/molFmoc-N-Amido-dPEG®6-Acid
CAS:<p>Fmoc-N-Amido-dPEG®6-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Fmoc-N-Amido-dPEG®6-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:575.65 g/mol[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide)
CAS:<p>[Tyr34]-Parathyroid Hormone (Bovine, 7-34 amide) is a product sourced from bovine, is available as a 0.5mg vial and is related to the peptide hormone Parathyroid Hormone (PTH). During abnormal serum calcium levels PTH is secreted from the parathyroid gland, thus regulating calcium and phosphate levels in the body. PTH binds to its PTH receptor which is a G-protein coupled receptor that activated adenylate cyclase or phospholipase C to activate pathways involved in the mediation of bone resorption and bone formation.</p>Fórmula:C156H244N48O40S2Pureza:Min. 95%Peso molecular:3,496 g/molLeu-Gly-Gly
CAS:<p>Leu-Gly-Gly is a cyclic peptide that binds to fibrinogen and forms stable complexes with the enzyme form of human serum albumin. It is used as a model system for studying the structure of proteins, and has been shown to bind calcium ions. Leu-Gly-Gly is also an amide and can form stable complexes with basic proteins such as fibrinogen. This peptide also has significant cytotoxicity against polymorphonuclear leucocytes, which may be due to its ability to inhibit polymerase chain activity.</p>Fórmula:C10H19N3O4Pureza:Min. 95%Peso molecular:245.28 g/molAzido-dPEG®12-Acid
CAS:<p>Azido-dPEG®12-Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®12-Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:643.72 g/molUrocortin (Rat)
CAS:<p>Urocortin is a peptide that is also known as corticotropin-releasing factor (CRF). It is an inhibitor of the protein phosphatase 1 and protein phosphatase 2A, which are enzymes that regulate the activity of other proteins. Urocortin also has the ability to bind to receptors for glucocorticoid hormones, such as GRP and MR, in a manner that activates them. This peptide is used in research studies to study ion channels, neuronal excitability, and other aspects of cell biology. Urocortin has been shown to be a high purity reagent with no detectable impurities.</p>Fórmula:C206H338N62O64Pureza:Min. 95%Peso molecular:4,707.3 g/molACTH (Human 1-24)
CAS:<p>ACTH (1-24) is a peptide hormone and neurotransmitter that belongs to the corticotropin-releasing factor family. It is also known as corticotropin-releasing hormone, adrenocorticotropic hormone, or CRH. ACTH binds to the ACTH receptor, which activates protein kinase A and cyclic AMP response element binding protein (CREB). Activation of these proteins leads to an increase in the production of cortisol. ACTH can be used as a research tool for studying ion channels and ligands. It can also be used as an antibody in cell biology research.</p>Fórmula:C136H210N40O31SPureza:Min. 95%Peso molecular:2,933.4 g/molm-dPEG®4-Thiol
CAS:<p>m-dPEG®4-Thiol is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®4-Thiol is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C57H113NO25S2Pureza:Min. 95%Peso molecular:1,276.63 g/molLipoamido-dPEG®12-Acid
CAS:<p>Lipoamido-dPEG®12-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®12-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C25H41N3O7S2Pureza:Min. 95%Peso molecular:559.74 g/molAzido-dPEG®35-Amine
CAS:<p>Azido-dPEG®35-Amine is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Azido-dPEG®35-Amine is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,627.94 g/molLipoamido-dPEG®24-Acid
CAS:<p>Lipoamido-dPEG®24-Acid is a PEG molecule conjugated with a lipid moiety. Lipoamido-dPEG®24-Acid, conjugated to this lipid constituent, is very important especially in drug delivery and vaccine development as it helps improve the stability and circulation time of lipid nanoparticles (LNPs) and liposomes.</p>Fórmula:C39H69N3O15S2Pureza:Min. 95%Peso molecular:884.11 g/molAmino-dPEG®12-t-Butyl Ester
CAS:<p>Amino-dPEG®12-t-Butyl Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Amino-dPEG®12-t-Butyl Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C31H63NO14Pureza:Min. 95%Peso molecular:673.83 g/molPropargyl-dPEG®1-NHS Ester
CAS:<p>Propargyl-dPEG®1-NHS Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Propargyl-dPEG®1-NHS Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C48H98N4O23Pureza:Min. 95%Peso molecular:1,099.3 g/molParathyroid Hormone (Human, 1-34)
CAS:This product which is available as a 0.1mg vial is amino acids 1-34 of the 84 amino acid parathyroid hormone (PTH) and can be used as an adenylate cyclase and bone growth stimulating peptide. It is also an effective anabolic agent used in the treatment of some forms of Osteoporosis. PTH is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications.Fórmula:C181H291N55O51S2Pureza:Min. 95%Peso molecular:4,117.7 g/moldPEG®24-Biotin Acid
CAS:<p>dPEG®24-Biotin Acid is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. dPEG®24-Biotin Acid is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C61H117N3O28SPureza:Min. 95%Peso molecular:1,325.6 g/mol2,3,4,6-Tetra-O-Acetyl-α-D-Glucopyranosyl Fluoride
CAS:2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride is a glycosyl fluoride that inhibits the enzyme glucosidase. This compound has been shown to inhibit peptide degradation and is used in studies of proteolytic enzymes. 2,3,4,6-Tetra-O-acetyl-α-D-glucopyranosyl fluoride has also been used as an inhibitor of carbohydrate metabolism and in the synthesis of glycoproteins.Fórmula:C14H19O9FPureza:Min. 95%Peso molecular:350.29 g/molSialylglycopeptide
CAS:<p>Sialylglycopeptide is an oligosaccharide that is present in the cell membrane of human erythrocytes. It has been shown to be a ligand for toll-like receptor 2, which is a pattern recognition receptor (PRR) that recognizes pathogen-associated molecular patterns. This molecule is also involved in the inflammatory response and in some infectious diseases. Sialylglycopeptide reacts with nitrite ions to form nitrosogalactopyranoside, which can lead to oxidative injury of cells such as those from the heart or lung. The sialylglycopeptides are also important for lactation, and their levels increase when pregnant women are exposed to glucocorticoids.</p>Fórmula:C112H189N15O7Pureza:Min. 95%Peso molecular:2,865.8 g/molPoly-L-Glutamic Acid Sodium Salt
CAS:<p>Poly-L-glutamic acid sodium salt (PGA) is a biodegradable polymer that can be used as a tissue sealant or to deliver drugs to specific sites in the body. It is also used in wound healing and in the treatment of inflammatory skin conditions such as psoriasis. PGA has been shown to stimulate antibody production, which may be due to its ability to act as an adjuvant for the formation of antibodies. This polymer has been shown to have a positive effect on diastolic and systolic blood pressure levels. PGA has also been shown to have a role in improving disease activity, with some evidence suggesting it may play a role in atrial fibrillation and cardiac function.</p>Fórmula:(C5H9NO4)x·XNaPureza:Min. 95%Bis-dPEG®2-Acid
CAS:<p>Bis-dPEG®2-Acid is a PEG polymer categorised as homobifunctional PEG (X-PEG X). Used as a linker, bis-dPEG®2-Acid is used to attached PEG to proteins, peptides, oligonucleotides, nanoparticles and small molecules via pegylation, a bioconjugation technique.</p>Fórmula:C24H42N2O11Pureza:Min. 95%Peso molecular:534.6 g/molTyrosyl-CNP-22 (Human)
CAS:<p>Tyrosyl-CNP-22 is a peptide that binds to the C-terminal domain of the human N-methyl-D-aspartate receptor (NMDAR) and inhibits its function. It can be used as a pharmacological tool for research. Tyrosyl-CNP-22 is also an activator of the NMDAR, which may have therapeutic applications in conditions such as epilepsy. The peptide has been shown to bind specifically to the NMDAR and inhibit the function of this receptor. This inhibition can be reversed by adding excess glutamate or glycine, which are neurotransmitters that are released from neurons during synaptic transmission. Tyrosyl-CNP-22 has been shown to activate the NMDAR and promote neuronal survival in acute brain injury models, which may have therapeutic implications for conditions such as epilepsy.</p>Fórmula:C102H166N28O30S3Pureza:Min. 95%Peso molecular:2,360.8 g/molCalcitonin (Human)
CAS:<p>Calcitonin is a hormone produced by the C cells (also known as parafollicular cells) in the thyroid gland. Its main function is to regulate the levels of calcium and phosphate in the blood. Calcitonin works by inhibiting the activity of osteoclasts, which are cells that break down bone tissue and release calcium and phosphate into the bloodstream. This leads to a decrease in the amount of calcium and phosphate in the blood.<br>Calcitonin is released in response to high levels of calcium in the blood, and it acts to reduce these levels by increasing the excretion of calcium by the kidneys and inhibiting the absorption of calcium by the intestines. It also promotes the storage of calcium in the bones, which helps to maintain their strength and density.<br>Calcitonin may be used therapeutically to treat conditions such as osteoporosis and hypercalcemia (high levels of calcium in the blood) or even diagnostically as a marker for tumors in medullary thyroid cancer.<br>This product has a disulfide bond between Cys1-Cys7 and is available as a 0.1mg vial.</p>Fórmula:C151H226N40O45S3Pureza:Min. 95%Peso molecular:3,417.8 g/molAc-Trp-OEt
CAS:<p>Ac-Trp-OEt is a tryptophan derivative that contains an acetyl group, a trityl group, and oleic acid. It is used as a substrate for enzyme assays to investigate the activation energies of enzymes such as chymotrypsin and chymotrypsin-like proteases. Ac-Trp-OEt is fluorescent in the presence of ultraviolet light, which can be detected using spectrophotometry. Ac-Trp-OEt has been used to study the activity of serine proteases such as neurokinin-1 receptor and collagenase. Ac-Trp-OEt also binds to chloride ions with high affinity, which can be used to study ion binding by ion exchange chromatography.</p>Fórmula:C15H18N2O3Pureza:Min. 95%Peso molecular:274.32 g/molBoc-Leu-Arg-Arg-AMC
CAS:Boc-Leu-Arg-Arg-AMC is a synthetic, nonpeptide antagonist of the CGRP receptor. It has been shown to inhibit the binding of peptides to the CGRP receptor and is used as a research tool for studying the pharmacology and protein interactions of this receptor. Boc-Leu-Arg-Arg-AMC has been shown to stimulate ion channel activity in vitro. This compound also has an affinity for antibodies that are specific for CGRP receptors, which can be used as a ligand in immunoassays.Fórmula:C33H52N10O7Pureza:Min. 95%Peso molecular:700.83 g/mol[Pmp1, Tyr(Me)2]-Arg8-Vasopressin
CAS:<p>[Pmp1, Tyr(Me)2]-Arg8-vasopressin is a peptide that has been shown to activate the V2 receptor and inhibit vasopressin-induced water retention. It has also been shown to inhibit the binding of vasopressin to its receptor. The peptide is an excellent research tool for studying the interaction between the V2 receptor and vasopressin. The peptide is supplied at high purity in lyophilized form and can be reconstituted with water or buffer before use.</p>Fórmula:C52H75N14O12S2Pureza:Min. 95%Peso molecular:1,152.4 g/molAmyloid Beta-Protein (Human, 1-40) (HCl Form)
CAS:<p>Amyloid beta-protein (Aβ) is a peptide that is derived from amyloid precursor protein (APP). Aβ is the main component of amyloid plaques which are found in the brains of people with Alzheimer's disease. It has been shown to be a ligand for LRP1 and LRP2, two receptors involved in the clearance of APP. Amyloid beta-protein (Aβ) is an activator of ion channels in cell membranes and can affect the activity of several types of ion channels, including high-voltage activated potassium channels and low-voltage activated calcium channels.</p>Fórmula:C194H295N53O58SPureza:Min. 95%Peso molecular:4,329.89 g/molChemotactic Peptide
CAS:<p>Chemotactic peptides are peptides that possess chemotactic properties, which means they attract cells. One well-known chemotactic peptide is For-Met-Leu-Phe (FMLP) and is a chemoattractant for phagocytic leukocytes and neutrophils. During the acute inflammatory response chemotactic factors activate neutrophils which have seven transmembrane G-protein coupled receptors. FMLP bind to these G-protein coupled receptors on the surface of neutrophils and activate NF- κB, MAPK and PI3K pathways. In particular FMLP is known to induce Interleukin-8 (IL-8) which is responsible for both tissue damage and the pathogenesis of inflammatory processes resulting from neutrophils. Chemotactic peptide have been used to study the function of polymorphonuclear leukocytes and other white blood cells in inflammation. Chemotactic peptides are often used as fluorescent probes to measure intracellular metabolic responses to chemoattractant stimulation.</p>Fórmula:C21H31N3O5SPureza:Min. 95%Peso molecular:437.55 g/molEndothelin-1 (Human)
CAS:Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure. Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11, sourced from Porcine, Canine, Rat, Mouse and Bovine and is available as a 0.5mg vial.Fórmula:C109H159N25O32S5Pureza:Min. 95%Peso molecular:2,491.9 g/molAc-Trp-Glu-His-Asp-AMC
CAS:<p>Ac-Trp-Glu-His-Asp-AMC is a peptide that can be used as a research tool in cell biology and pharmacology. Ac-Trp-Glu-His-Asp-AMC has been shown to inhibit ion channels, which are proteins that control the flow of ions across the cell membrane. It binds to specific receptor sites on the outside of cells, which causes conformational changes in the ion channel that prevent it from opening. Ac-Trp-Glu-His-Asp AMC has been shown to increase the intracellular concentration of calcium ions, which is necessary for muscle contraction and other cellular processes.</p>Fórmula:C38H40N8O11Pureza:Min. 95%Peso molecular:784.77 g/molm-dPEG®24-Azide (Azido-m-dPEG®24)
CAS:<p>m-dPEG®24-Azide (Azido-m-dPEG®24) is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. m-dPEG®24-Azide (Azido-m-dPEG®24) is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:1,142.32 g/molBz-Gly-His-Leu • H2O [Hippuryl-Histidyl-Leucine]
CAS:Bz-Gly-His-Leu is a peptide that has the amino acid sequence of Hippuryl-Histidyl-Leucine. The peptide binds to Angiotensin I Converting Enzyme I Substrates and prevents the enzyme from converting Angiotensin I to Angiotensin II, thereby lowering blood pressure. Bz-Gly-His-Leu has been shown to be effective in reducing blood pressure in patients with congestive heart failure as well as those with normal cardiac function.Fórmula:C21H27N5O5•H2OPureza:Min. 95%Peso molecular:447.49 g/molThyrotropin Releasing Hormone (TRH) (Human, Ovine, Porcine, Rat)
CAS:Thyrotropin releasing hormone (TRH) is a peptide that is produced in the hypothalamus. It has various functions, including being an activator of thyroid stimulating hormone (TSH) and releasing growth hormone from the anterior pituitary gland. TRH also has anti-inflammatory effects and is used as a research tool in cell biology. TRH binds to receptors on cells and can activate ion channels, which causes an influx of calcium ions into cells. This leads to the activation of protein kinases, which are important in cell signaling pathways. TRH also interacts with other proteins, such as receptor tyrosine kinases and G-protein coupled receptors.Fórmula:C16H22N6O4Pureza:Min. 95%Peso molecular:362.38 g/mol1-Deoxyfructosyl-Val
CAS:<p>1-Deoxyfructosyl-Val is a research tool used to study the roles of ligands and receptors. 1-Deoxyfructosyl-Val binds to active sites on ion channels and blocks the flow of ions through these channels. This can be an important factor in the regulation of muscle contraction, nerve transmission, and other processes in living cells. 1-Deoxyfructosyl-Val is an inhibitor that is used to study protein interactions. It has been shown that 1-deoxyfructosyl-val can inhibit the binding of antibodies to peptides, which are small proteins.</p>Fórmula:C11H21NO7Pureza:Min. 95%Peso molecular:279.29 g/molOsteocalcin (Human, 38-49) Antiserum (Rabbit)
<p>Osteocalcin (OC) is a bone-specific protein that plays important roles in bone metabolism. It is involved in the regulation of bone mineralization and turnover, as well as the formation of new bone matrix. The OC protein is a member of the family of bone regulatory proteins, which includes osteopontin and sclerostin. It interacts with many other proteins such as ion channels, receptors, and ligands. This antibody has been used to identify OC protein interactions with these proteins. It can be used for research purposes in pharmacology or cell biology applications.</p>Pureza:Min. 95%Brazzien (2-54)
<p>Brazzien (2-54) is a peptide that binds to the extracellular domain of the human receptor for Advanced Glycation Endproducts (RAGE). This receptor plays an important role in many cellular processes, including tissue damage and inflammation. Brazzien (2-54) is a potent inhibitor of RAGE activity and has been shown to inhibit the binding of RAGE ligands to RAGE.</p>Pureza:Min. 95%Substance P (Human, Bovine, Rat, Mouse)
CAS:Substance P is a member of the tachykinin neuropeptide family which is produced in the central nervous system (CNS) and acts through its specific receptor neurokinin 1 receptor (NK-1R). NK-1R is present in neurons and on glial cell types. Substance P is involved in: pain perceptions as a neurotransmitter; gut motility; increased inflammation in the lungs, gastrointestinal tract and the skin and neuroinflammation. Interestingly the levels of Substance P are raised in inflammatory bowel diseases and through its involvement in cytokine release, it contributes to asthma pathology. These diverse selection of functions makes substance P a target for therapeutic research.Fórmula:C63H98N18O13S•3CH3COOH•5H2OPureza:Min. 95%Peso molecular:1,617.84 g/molDOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide
<p>DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA-tris(Acid)-Amido-dPEG®3-Bromoacetamide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:927.64 g/molMAL-dPEG®4-Glu(TFP e=Ester)-NH-m-dPEG®24
<p>MAL-dPEG®4-Glu(TFP Ester)-NH-m-dPEG®24 is a peptide containing polyethylene glycol (PEG) as spacer to alter their pharmacokinetic properties and pharmodynamics.</p>Fórmula:C78H134F4N4O35Pureza:Min. 95%Peso molecular:1,763.9 g/molCH3O-PEG-NH2
<p>CH3O-PEG-NH2 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. CH3O-PEG-NH2 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Carboxyl-dPEG®4-(m-dPEG®12)3
CAS:<p>Carboxyl-dPEG®4-(m-dPEG®12)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. Carboxyl-dPEG®4-(m-dPEG®12)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Pureza:Min. 95%Peso molecular:2,323.73 g/molIL 5 Human
<p>IL-5 is a cytokine that belongs to the group of hematopoietic cytokines. It is an activator of B cells and eosinophils, which are involved in the immune response to infection. IL-5 also stimulates the production of immunoglobulin E (IgE), a type of antibody that plays an important role in allergic reactions. IL-5 has been shown to inhibit ion channels and protein interactions. This molecule is a receptor for a ligand called stem cell factor, which plays an important role in the development and function of white blood cells. The CAS number for IL-5 is 57748-87-6.</p>Pureza:Min. 95%Anti Met-Enkephalin-Arg6-Gly7-Leu8 Serum
<p>Anti Met-Enkephalin-Arg6-Gly7-Leu8 Serum is a research tool for the study of ion channels, ligands and receptors. Anti Met-Enkephalin-Arg6-Gly7-Leu8 Serum blocks the binding of peptides to receptors and can be used to determine the specificity of receptor binding. Anti Met-Enkephalin-Arg6-Gly7-Leu8 Serum is also a useful reagent in cell biology, as it can be used to block peptide interactions with proteins such as ion channels or membrane receptors. The antibody has been shown to inhibit the activity of the enzyme tyrosine phosphatase, which regulates cellular growth and differentiation.</p>Pureza:Min. 95%Fmoc-N-Lys-(dPEG®12-Biotin)-OH-(Acid)
CAS:<p>Please enquire for more information about Fmoc-N-Lys-(dPEG®12-Biotin)-OH-(Acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H22O8Pureza:Min. 95%Peso molecular:294.3 g/molIGF-Like Family Receptor 1, human, recombinant
<p>IGF-Like Family Receptor 1 is a recombinant protein that belongs to the receptor family. It is also known as insulin-like growth factor I (IGF-I) receptor, and it has been shown to have ion channel activity. IGF-Like Family Receptor 1 can be used in research and development of pharmacological agents. This recombinant protein will not react with any antibodies or peptides, and it has high purity.</p>Pureza:Min. 95%Apolipoprotein E C-term Heavy Tryptic Peptide Standard (4nmol)
An apolipoprotein E C-term heavy tryptic peptide standard for use in protein identification and quantitation studies. As part of a fat-binding protein family, apolipoprotein E plays a role in the metabolism of fats in the body through interacting with the low density lipoprotein receptor, which is involved in the catabolism of triglyceride rich lipoproteins. Apolipoprotein E is also a major component in cholesterol metabolism and is a carrier of cholesterol in the brain. Additionally when forming a complex with C1q, apolipoprotein E is an inhibitor of the classical complement pathway. The N and C terminal regions of apolipoprotein are connected by a hinge region and the C-terminal region is a hydrophobic surface made up of three alpha helices and a low density lipoprotein receptor binding site.Pureza:Min. 95%Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus]
<p>Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is a high purity, recombinant protein that can be used as a research tool in cell biology, receptor pharmacology and biochemistry. It can also be used as an antibody to detect the presence of SARS coronavirus in cells. Putative orf1ab Polyprotein (3233-3247) [SARS Coronavirus] is an inhibitor of ion channels and ligand for receptor.</p>Pureza:Min. 95%VEGI Human
<p>VEGI Human is a cytokine that belongs to the group of proteins. Cytokines are small proteins that act as chemical messengers and regulators in the immune system. They are involved in the regulation of immune responses, including induction, activation, and suppression. VEGI Human is a cytokine that regulates the production of other cytokines. VEGI Human has been shown to have anti-inflammatory properties and can be used for the treatment of inflammation-related diseases such as asthma and arthritis.</p>Pureza:Min. 95%[D-Ala2,D-Leu5]-Enkephalin
CAS:Producto controlado<p>Enkephalins are endogenous opioid peptides that inhibit pain and have a variety of other physiological effects. They bind to specific receptors on the surface of neurons, which are called opioid receptors. Enkephalin is a peptide consisting of two amino acids, D-Ala2,D-Leu5. Enkephalins can be produced by linking two amino acids together with an amide bond or by modifying one of the amino acids in the sequence. This drug has been shown to induce mitochondrial membrane depolarization in hippocampal cells and autophagy in neuronal cells. It also has antinociceptive properties and is able to penetrate the blood-brain barrier due to its absorption enhancer property. The drug is also able to induce locomotor activity in mice and cause neuronal death in vivo models.</p>Fórmula:C29H39N5O7•CH3COOH•H2OPureza:Min. 95%Peso molecular:647.72 g/molPentraxin-3, human, recombinant
<p>Pentraxin-3 is a peptide that is an inhibitor of the activator protein. It is used in pharmacology and cell biology research to identify ligands, receptors, and ion channels. Pentraxin-3 has shown to be a useful research tool for learning about the activation of various types of ion channels, including nicotinic acetylcholine receptors, glutamate receptors, and voltage-gated potassium channels. It can also be used as an antibody to identify cells that have been activated by specific ligands or signaling pathways.</p>Pureza:Min. 95%t-boc-NH-dPEG®24-Tris (-TFP Ester)3
<p>t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. t-boc-NH-dPEG®24-Tris (-TFP Ester)3 is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C87H132F12N2O36Pureza:Min. 95%Peso molecular:2,009.97 g/molParathyroid Hormone (Human, 39-84)
<p>Parathyroid hormone (PTH) is a peptide hormone that regulates the calcium and phosphate levels in the blood. It is produced by the parathyroid glands, located near the thyroid gland in the neck. PTH increases blood calcium levels by increasing bone breakdown, stimulating bone formation, and increasing reabsorption of calcium. This protein also stimulates phosphaturia to increase serum phosphate levels.</p>Fórmula:C211H357N67O72Pureza:Min. 95%Peso molecular:4,984.5 g/molAnti PTH (1-15) (Rat) Serum
Anti PTH (1-15) (Rat) Serum is a research tool that is used to study the activity of the parathyroid hormone. This product can be used as an activator or ligand in cell biology experiments. It has been shown to have a high affinity for the parathyroid hormone receptor and can be used to study protein interactions. Anti PTH (1-15) (Rat) Serum can also be used in pharmacological studies and may inhibit ion channels. This product has been shown to bind with peptides, which are small proteins, as well as antibodies and it may also inhibit protein synthesis.Pureza:Min. 95%DMD MS Calibrator-2 (25nmol)
<p>The dystrophin protein is encoded for by the DMD gene which when mutated can result in a muscle-wasting diseases, Becker and Duchenne muscular dystrophy. As a member of the β-spectrin/α-actinin protein family the dystrophin cytoskeletal protein has a NH2 – terminal actin binding domain and spectrin-like repeats. This product can be used as a peptide calibrator for Mass Spectroscopy research.</p>Pureza:Min. 95%Adrenomedullin (Human, 1-25)
<p>Adrenomedullin (Human, 1-25) is a vasopressor fragment of the human peptide hormone adrenomedulin. This product has a disulfide bond between Cys16-Cys21 and is available as a 0.5mg vial.</p>Fórmula:C125H192N40O36S3Pureza:Min. 95%Peso molecular:2,927.3 g/molNHS-dPEG®4-( m-dPEG®12)3-Ester
CAS:<p>NHS-dPEG®4-( m-dPEG®12)3-Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. NHS-dPEG®4-( m-dPEG®12)3-Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C58H106N6O26Pureza:Min. 95%Peso molecular:1,303.49 g/molPeroxiredoxin-2, human, recombinant
<p>Peroxiredoxin-2 is a protein that belongs to the peroxidase family of enzymes. It has been shown to be an activator of ion channels, which suggests that it may play a role in cell regulation. Peroxiredoxin-2 has also been shown to bind to peptides and antibodies, with potential therapeutic applications.</p>Pureza:Min. 95%Glutathione Synthetase , human, recombinant
<p>Glutathione synthetase is an enzyme that catalyzes the synthesis of glutathione from gamma-glutamylcysteine and glycine. It is a homodimeric protein composed of two identical subunits with a molecular weight of about 30 kDa. Each subunit contains one active site for the catalysis. The recombinant human glutathione synthetase has been shown to be stable in different pH buffers and can be used as a research tool or an inhibitor in cell biology experiments.</p>Pureza:Min. 95%High-Mobility Group Box 1, human, recombinant
<p>HMGB1 is a protein that belongs to the family of high-mobility group box proteins. It is involved in regulating the release of inflammatory mediators and cytokines, such as IL-1β, IL-6, TNF-α and MCP-1. HMGB1 also plays a role in activation of neutrophils and macrophages. The recombinant form of HMGB1 has been shown to be an excellent research tool for studying protein interactions and receptor ligand interactions. High purity HMGB1 can be used as a pharmacological inhibitor or activator.</p>Pureza:Min. 95%Ceruloplasmin Heavy Tryptic Peptide Standard (4nmol)
<p>A Ceruloplasmin Heavy Tryptic Peptide Standard for use in protein identification and quantitation studies. Ceruloplasmin is a serum ferroxidase key to transporting copper in the blood. It also plays a role in iron metabolism regulation and the pathogenesis of Wilson disease. Furthermore it has been found in elevated levels during inflammation.</p>Pureza:Min. 95%Argininosuccinate Lyase, human, recombinant
<p>Argininosuccinate lyase is an enzyme that catalyzes the reaction of arginine and fumarate to form urea and ornithine. It is a homodimer with each subunit containing four domains. The active site of argininosuccinate lyase is located in domain 1, which contains a zinc ion coordinated by two histidine residues, a glutamate residue, and a water molecule. The enzyme is composed of one polypeptide chain that has three domains: the N-terminal domain (domain 1), the middle domain (domain 2), and the C-terminal domain (domain 3). Argininosuccinate lyase has been shown to be present in Escherichia coli as well as in human tissues.</p>Pureza:Min. 95%Borrelia Burgdorferi Outer Surface Protein A (recombinant)
The recombinant Borrelia Burgdorferi Outer Surface Protein A (rBOSPA) is a peptide that can be used as a research tool for studying the activation of ion channels and protein interactions. The rBOSPA is an inhibitor of the hKv1.3 channel and has been shown to bind to the GABA receptor. This recombinant protein is purified from E. coli, which makes it suitable for use in experimentation, as it does not contain any potential contaminants or other proteins. The CAS number for this product isPureza:Min. 95%sTfR Light Tryptic Peptide Standard (4nmol)
<p>A soluble transferrin receptor (sTfR) light tryptic peptide standard for protein identification and quantitation studies. sTfR is a cleaved extracellular segments of the transferrin receptor 1 and it can be used to measure the status of iron in the blood and thus help in studies into anemia, where iron is deficient.</p>Pureza:Min. 95%Fmoc Gly TentaGel® S RAM resin (particle size: 90 µm capacity: 0.2 - 0.25 mmol/g)
Please enquire for more information about Fmoc Gly TentaGel® S RAM resin (particle size: 90 µm capacity: 0.2 - 0.25 mmol/g) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%C-Peptide II (Mouse)-EIA Kit (1ea)
<p>C-Peptide II (Mouse)-EIA Kit is a Mouse C-Peptide II (C-PEPTIDE) ELISA Kit. This kit is designed to measure the level of C-peptide in mouse serum by using a sandwich enzyme immunoassay. The assays are carried out in microtiter plates coated with monoclonal antibodies specific for mouse C-peptide. After incubation, unbound material is removed and the wells are washed. The amount of bound mouse C-peptide is then determined by adding an enzyme conjugate that reacts with the mouse C-peptide and measuring the degree of color development with a spectrophotometer.</p>Pureza:Min. 95%1-Deoxyfructosyl-Val-His-Leu-Thr-Pro-Glu
CAS:1-Deoxyfructosyl-Val-His-Leu-Thr-Pro-Glu is a peptide that binds to ion channels in the cell membrane. It has been shown to activate some receptors and inhibit others, which may be useful for research. The peptide also has an antibody against it, so its purity can be confirmed.Fórmula:C37H60N8O15Pureza:Min. 95%Peso molecular:856.92 g/molMAL-dPEG®36-TFP Ester
<p>MAL-dPEG®36-TFP Ester is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. MAL-dPEG®36-TFP Ester is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.</p>Fórmula:C25H35F4NO7S2Pureza:Min. 95%Peso molecular:601.67 g/molPolystyrene AM NH2 (particle size: 250 - 315 µm capacity: 0.8 - 1.2 mmol/g)
<p>Please enquire for more information about Polystyrene AM NH2 (particle size: 250 - 315 µm capacity: 0.8 - 1.2 mmol/g) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%α-1-Acid Glycoprotein Light Tryptic Peptide Standard (4nmol)
Alpha-1-Acid Glycoprotein light tryptic peptide standard for protein identification and quantitation. Alpha-1-Acid Glycoprotein is an acute phase protein whose concentration in serum increases during, infection, inflammation and tissue injury.Pureza:Min. 95%INSL3
<p>Insl3 is a protein that is localized in the ovary and human chorionic gonadotropin. It is also found in human serum. In animals, Insl3 causes fertility. In humans, it stimulates the development of the gubernaculum, which attaches to the testes. The expression of Insl3 increases during puberty and continues to be expressed throughout adulthood. Insl3 is translated from mRNA as a precursor protein with an N-terminal signal peptide sequence that directs its secretion from the cell into the extracellular space. The Insl3 precursor protein has two C-terminal domains: an internal domain and a carboxy-terminal domain. These domains are translated from separate initiation codons on one mRNA molecule. The internal domain contains sequences for translation initiation, ribosome binding sites, and translational stop codons; these sequences are not present in the carboxy-terminal domain. Insl3 can be detected by using an</p>Pureza:Min. 95%β-Defensin-2, human
<p>β-Defensin-2 is a protein that belongs to the class of defensins. It has been shown to have antimicrobial activity against a wide range of microorganisms and to be an activator of ion channels. β-Defensin-2 is also a ligand for the GPR18 receptor, which may be involved in the regulation of pain perception. β-Defensin-2 is purified from human leukocytes and has a purity of >98%.</p>Fórmula:C188H305N55O50S6Pureza:Min. 95%Peso molecular:4,328.2 g/molNPY, humanAntiserum
<p>NPY is a peptide that is released by neurons and acts as an activator. It is also found in the central nervous system and regulates appetite, as well as other autonomic, behavioral, and endocrine functions. NPY has been shown to be an inhibitor of ion channels in the central nervous system. NPY has been shown to bind to receptors on the surface of cells, which are ligands for NPY. This binding activates or inhibits the receptor's signaling pathway. The CAS number for NPY is 1139-14-1 and it has a molecular weight of 9.6 kDa.END></p>Pureza:Min. 95%[D-Ala2,Met5]-Enkephalinamide
CAS:[D-Ala2,Met5]-Enkephalinamide is a peptide that belongs to the group of opioid peptides. It acts as an agonist and binds to the µ-opioid receptor. This receptor is involved in transmitting signals from outside the cell to inside the cell by regulating ion channels and controlling protein interactions. The binding of [D-Ala2,Met5]-Enkephalinamide to this receptor results in an inhibitory effect on neurotransmitter release, leading to a decrease of pain sensation. It has also been shown that [D-Ala2,Met5]-Enkephalinamide can act as an antagonist at other opioid receptors, such as the κ-opioid receptor.Fórmula:C28H38N6O6SPureza:Min. 95%Peso molecular:586.7 g/mol
