Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30315 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
ACV trifluoroacetate salt
CAS:ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt is a nonheme iron that has been shown to be an oxidizing agent. It is used in the synthesis of antibiotics and other organic compounds. ACV trifluoroacetate salt H-Aad (Cys-D-Val-OH)-OH trifluoroacetate salt also has synthetase activity, which catalyzes the formation of a thiolate ligand from two molecules of acetyl coenzyme A (ACCOA) and one molecule of propionyl coenzyme A (PCCOA). This ligand binds to metal ions such as Fe2+, which are then reduced to Fe3+ by the metal cluster. The water ligands on the coordination sphere may be replaced by other ligands, such as lysine.Fórmula:C14H25N3O6SPureza:Min. 95%Peso molecular:363.43 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H36N6O6Peso molecular:552.64 g/molBAD (103-127), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H212N42O39SPeso molecular:3,103.54 g/molPLM derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H96N24O12Peso molecular:1,213.47 g/molFas C-Terminal Tripeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C16H29N3O6Peso molecular:359.43 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H97N17O19Peso molecular:1,348.53 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:<p>Catalogue peptide; min. 95% purity</p>Fórmula:C121H193N33O30SPeso molecular:2,638.15 g/molSALMF amide 1 (S1)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H60N10O10SPeso molecular:885.1 g/molBiotin-Obestatin (rat)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C124H188N36O33Peso molecular:2,743.17 g/molR-G-D-S-P-A-S-S-K-P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H68N14O16Peso molecular:1,001.07 g/molAmyloid Bri Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C173H273N49O52S2Peso molecular:3,935.55 g/molAtrial Natriuretic Factor (4-28) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H175N39O35S3Peso molecular:2,724.02 g/molSelectin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H105N16O18S2Peso molecular:1,426.75 g/molCecropin A (1-7)-Melittin A (2-9) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C89H152N22O15Peso molecular:1,770.34 g/molBiotin-Angiotensin I, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H103N19O16SPeso molecular:1,522.81 g/molAmyloid beta-Protein (25-35) amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H82N14O13SPeso molecular:1,059.31 g/molα-Conotoxin MI
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C58H92N22O17S4Peso molecular:1,497.74 g/molbeta-Endorphin (1-26), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C130H208N32O38SPeso molecular:2,859.36 g/molRSK Substrate, S6 (231-239)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H88N22O11Peso molecular:1,113.34 g/mol[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C26H33N5O5Peso molecular:495.58 g/molCDPKS, Syntide analog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H86N16O13Peso molecular:1,083.31 g/molHypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C180H287N57O48Peso molecular:4,017.55 g/molBiotin-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H118N20O21S3Peso molecular:1,864.21 g/molDynorphin A (8-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H96N18O15Peso molecular:1,297.53 g/mol[D-Ala2] Met-Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H37N5O7SPeso molecular:587.70 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C60H102N16O17Peso molecular:1,319.58 g/molHelodormin
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H285N47O49Peso molecular:3,843.47 g/molCaspase 2 Substrate 1m (ICH-1), fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H44N6O12Peso molecular:716.8 g/molBiotin-LC-Protein Kinase G Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H121N25O18SPeso molecular:1,621 g/molAc-a-CGRP (19-37) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C88H139N25O26Peso molecular:1,963.24 g/molPreprogalanin 28-67, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C198H312N62O58Peso molecular:4,488.96 g/molbeta-Amyloid (13-27)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C84H126N24O24Peso molecular:1,856.09 g/molBiotin-Obestatin (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C126H190N34O35Peso molecular:2,773.19 g/molBiotin-a-CGRP (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C173H281N53O51S2Peso molecular:4,015.69 g/molbeta-Amyloid Protein Precursor (657-676)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C95H152N30O31Peso molecular:2,210.45 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C164H278N58O45S4Peso molecular:3,910.64 g/molSarafotoxin S6d
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H167N27O34S5Peso molecular:2,596 g/molEndothelin-1 (1-15), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H108N16O24S5Peso molecular:1,718.02 g/molAngiotensinogen (1-13)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H116N22O17Peso molecular:1,645.9 g/molInterleukin II (60-70)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C68H104N14O14SPeso molecular:1,373.74 g/molKinase Domain of Insulin Receptor (4)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H108N19O27Peso molecular:1,702.77 g/molMurine CMV pp 89 (170-174)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C29H41N7O7SPeso molecular:631.76 g/molScyliorhinin II, amide ,dogfish
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C77H119N21O26S3Peso molecular:1,851.1 g/mol[Lys15]-Amyloid beta-Protein (15-21)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H69N9O8Peso molecular:852.10 g/molHistone H1-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C56H101N17O15Peso molecular:1,252.53 g/molabII probe
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H101N19O19SPeso molecular:1,460.69 g/molAutocamtide-3 [KKALHRQETVDAL]
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H113N21O20Peso molecular:1,508.75 g/mol[D-Pro10]-Dynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C63H103N21O13Peso molecular:1,362.66 g/molbeta-Amyloid (11-22)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H102N18O18Peso molecular:1,483.70 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H134N26O26SPeso molecular:1,980.25 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H97N21O14SPeso molecular:1,512.8 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C219H357N67O56S2Peso molecular:4,888.83 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H77N21O12Peso molecular:1,068.22 g/molBig Endothelin-1 (22-39), rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H135N25O27Peso molecular:5,511 g/mol[Val35] -beta-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C203H311N55O60Peso molecular:4,481.96 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecular:1,745.99 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H97N21O16S1Peso molecular:1,424.66 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C79H125N23O28SPeso molecular:1,877.08 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C142H223N35O53S2Peso molecular:3,332.68 g/mol[Val5,Asn9]-Angiotensin I
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H86N16O15Peso molecular:1,259.44 g/molC-terminal Proghrelin Isoform Peptide, mouse
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H86N22O17Peso molecular:1,267.38 g/molPrepro-adrenomedullin (153-185), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H224N42O43Peso molecular:3,219.56 g/molMyosin Kinase Inhibiting Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C40H78N18O11Peso molecular:987.2 g/molSalusin-α
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C114H192N40O30Peso molecular:2,602.99 g/molBiotin-Kinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H122N21O29SPeso molecular:1,777.92 g/molAGRP (54-82)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C137H225N39O54Peso molecular:3,282.47 g/molSomatostatin-14 (3-10)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H72N12O11SPeso molecular:1,073.28 g/molMSH Release Inhibiting Factor, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C13H24N4O3Peso molecular:284.36 g/molH-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt
CAS:Producto controladoPlease enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C47H84N18O8Pureza:Min. 95%Peso molecular:1,029.29 g/molbeta-Casein (90-96)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/mol[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C143H226N46O39Peso molecular:3,213.6 g/molPre-S1 (12-32)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C104H154N26O31SPeso molecular:2,296.61 g/mol[Ser25]-PKC (19-36) Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C93H159N35O25Peso molecular:2,167.52 g/molbFGF Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H53N11O11Peso molecular:815.89 g/molAmyloid Dan Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C185H270N48O51S2Peso molecular:4,046.63 g/molBiotin-Amyloid beta-Protein (1-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C213H325N57O62S2Peso molecular:4,740.44 g/molLF 20 Consensus Peptide. Anthrax Related Lethal Factor
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C106H173N29O27S2Peso molecular:2,349.87 g/molα-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H87N15O9SPeso molecular:1,206.53 g/molTax8, HTLV-1 (12-19)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C50H68N8O11Peso molecular:957.15 g/molSH2 Domain Ligand (5)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C41H62N7O16PSPeso molecular:972.05 g/molbeta-Amyloid (16-26)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H86N12O17Peso molecular:1,211.39 g/molAc-Hirudin (55-65) (desulfated)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C66H92N12O25Peso molecular:1,453.53 g/molDendroaspis Natriuretic Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C180H282N56O56S2Peso molecular:4,190.72 g/molPKA Inhibitor Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H108N25O22PPeso molecular:1,574.69 g/molVIP (1-12), human, porcine, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H88N18O22Peso molecular:1,425.49 g/mol[Arg91, Ala96]-MBP (87-99), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H112N22O17Peso molecular:1,557.83 g/molExendin 4 (3-39)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C176H271N46O58S1Peso molecular:3,991.36 g/molBiotin-Insulin Receptor (1142-1153)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C82H121N21O26Peso molecular:1,849.07 g/molRS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H85N25O15Peso molecular:1,204.33 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C103H175N35O27SPeso molecular:2,367.83 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C76H128N24O25SPeso molecular:1,810.07 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C53H91N21O14Peso molecular:1,246.45 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C116H164N32O31SPeso molecular:2,534.86 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H114N24O19Peso molecular:1,655.89 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C108H159N23O39S2Peso molecular:2,467.72 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C45H64N14O11Peso molecular:977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C264H406N80O77S3Peso molecular:6,028.72 g/molCalpain Inhibitor Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C140H227N35O44SPeso molecular:3,136.64 g/molPKCe pseudosubstrate derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C83H155N39O21SPeso molecular:2,067.47 g/molα-CGRP (19-37), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C86H137N25O25Peso molecular:1,921.20 g/mol[D-Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H38N6O6SPeso molecular:586.72 g/molPAR-1-selective peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H58N10O9Peso molecular:762.91 g/molbeta-Bag Cell Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C33H53N13O6Peso molecular:727.87 g/molPro-Adrenomedullin N20, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C112H178N36O26Peso molecular:2,444.83 g/molCalcitonin C-terminal Adjacent Peptide, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C82H117N23O27SPeso molecular:1,889.05 g/molbeta-Lipotropin (1-10), porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C42H66N10O15Peso molecular:951.05 g/mol[Leu144]-PLP (139-151), L144-PLP(139-151)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C67H105N19O17Peso molecular:1,448.70 g/mol[Tyr12]-Somatostatin-28 (1-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C65H107N23O20SPeso molecular:1,562.78 g/molKinase Domain of Insulin Receptor (2)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C72H108N19O27PPeso molecular:1,702.77 g/molGLP-2 (1-33) (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C165H254N44O55SPeso molecular:3,766.1 g/molbeta-Casomorphin (1-5) (bovine)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H37N5O7Peso molecular:579.66 g/molp34cdc2-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H104N16O19Peso molecular:1,377.62 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C155H237N46O46SPeso molecular:3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C48H75N17O11Peso molecular:1,066.24 g/molIL-8 Inhibitor
CAS:IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys-Arg-NH2 is a molecule that blocks the receptor for IL-8, a c-c chemokine. This leads to reduced inflammation and decreased activation of cells in the inflammatory process. IL-8 Inhibitor Ac-Arg-Arg-Trp-Trp-Cys--Arg--NH2 has been shown to be effective in reducing chronic bronchitis and pancreatitis in animal models. The effective dose for IL 8 inhibitor is not yet known.Fórmula:C45H66N18O7SPureza:Min. 95%Peso molecular:1,003.19 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C75H122N20O15Peso molecular:1,543.93 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C119H182N34O31Peso molecular:2,584.92 g/mol4A/4B, 5A/5B Peptide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C49H73N11O22S3Peso molecular:1,264.38 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C89H141N25O22Peso molecular:1,913.27 g/molFmoc-Mating Factor a
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C97H125N20O19SPeso molecular:1,907.26 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C61H77N13O16Peso molecular:1,248.37 g/mol[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C57H87N15O22S3Peso molecular:1,430.61 g/molMMP-2/MMP-9 Inhibitor III
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C52H73N13O14S2Peso molecular:1,168.35 g/molGIP, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C225H342N60O66SPeso molecular:4,975.66 g/mol[Tyr4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C55H85N21O18Peso molecular:1,328.42 g/molIntermedin (human)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C219H351N69O66S3Peso molecular:5,102.84 g/molBiotin-Galanin, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C149H224N44O45SPeso molecular:3,383.78 g/molGlucagon-Like Peptide 1, (GLP-1) amide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C184H273N51O57Peso molecular:4,111.53 g/mol[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H121N23O20Peso molecular:1,652.93 g/molCys-Gly-Lys-Lys-Gly-Amyloid beta-Protein (36-42)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C47H85N14O13SPeso molecular:1,087.35 g/molDynorphin (2-17), amide, porcine
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C90H147N31O20Peso molecular:1,983.37 g/molα-Bag Cell Peptide (1-7)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H67N13O9Peso molecular:922.11 g/molSomatostatin-14 (3-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C71H96N16O17S2Peso molecular:1,509.78 g/molBax-BH3L63A
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C74H129N22O27SPeso molecular:1,791.05 g/mol[Lys8,Asn9] Neurotensin LANT-6 (8-13)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C36H58N8O9Peso molecular:746.91 g/molCalmodulin-Dependent Protein Kinase II (281-309)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C146H254N46O39S3Peso molecular:3,374.05 g/mol[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C44H64N14O10S2Peso molecular:1,013.22 g/mol[D-Trp2,7,9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C80H109N21O13SPeso molecular:1,604.96 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C102H152N26O29Peso molecular:2,206.51 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C69H116N24O22Peso molecular:1,633.84 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C109H161N25O29S2Peso molecular:2,349.78 g/molbeta-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C59H102N16O21SPeso molecular:1,403.63 g/molACTH (12-39), rat
Catalogue peptide; min. 95% purityFórmula:C145H227N39O41Peso molecular:3,172.66 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C171H271N51O54S2Peso molecular:3,969.50 g/molFmoc-Phe-Pro-OH
CAS:<p>Fmoc-Phe-Pro-OH is a sensor molecule that has been used in supramolecular, nanostructured, and biological applications. It is a supramolecular self-assembly process that can be applied to sensors, devices, and modules. Fmoc-Phe-Pro-OH can be used as a biological source for sensing bacteria or other molecules of interest. The structural properties of Fmoc-Phe-Pro-OH have been studied extensively and it has been found to have favorable properties for use in humans. Advances in this field are ongoing with the hope of improving the understanding of biological systems and human health.</p>Fórmula:C29H28N2O5Pureza:Min. 95%Peso molecular:484.54 g/molSaposin C12
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C62H108N16O22Peso molecular:1,429.65 g/molH-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid
CAS:<p>H-Gly-Asp-Asp-Asp-Asp-Lys-bNA trifluoroacetic acid is a peptide that is used as a biocatalyst in the production of microspheres. It is also known as enterokinase, and cleaves proteins at their N termini. This enzyme has been immobilized on silica gel and then applied to the production of microspheres. The half life of this enzyme is 1 hour at 37°C, but it can be increased to 8 hours by immobilizing it on silica gel using glutaraldehyde. HGAASDAAKLysBNAtrifluoroacetic acid has been shown to have a high specific activity with an efficiency of 60% and a pH range between 4 and 10. It has been shown to have high protein cleavage rates at 30°C, 37°C, and 40°C, with bovine serum albumin being the</p>Fórmula:C38H45N8O16F3Pureza:Min. 95%Peso molecular:788.76 g/molNeo-Kyotorphin
CAS:<p>Catalogue peptide; min. 95% purity</p>Fórmula:C28H47N9O9Peso molecular:653.74 g/molN-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C43H65O7N9Peso molecular:824.04 g/molPrepro TRH (53-74)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C118H182N32O32Peso molecular:2,560.96 g/mol[beta-Ala8]-Neurokinin A (4-10)
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C35H56N8O10SPeso molecular:781 g/molFluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Asp(OMe)-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C43H45FN4O16Pureza:Min. 95%Peso molecular:892.83 g/molH-Glu-Glu-OH
CAS:<p>H-Glu-Glu-OH is an organic acid that has proteolytic and gene product properties. It is a hyperactive compound that can be used as a sample preparation reagent for the detection of glutamic acid in proteins. H-Glu-Glu-OH inhibits protein synthesis by binding to ribosomes, which are responsible for the production of proteins in the cell, and prevents their function. Magnetic resonance spectroscopy has been used to investigate the uptake of H-Glu-Glu-OH into mammalian cells and ovarian follicles.</p>Fórmula:C10H16N2O7Pureza:Min. 95 Area-%Forma y color:White PowderPeso molecular:276.24 g/molAbz-Amyloid β/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt
CAS:Please enquire for more information about Abz-Amyloid beta/A4 Protein Precursor770 (669-674)-EDDnp trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C43H62N12O15SPureza:Min. 95%Peso molecular:1,019.09 g/molAdrenomedullin (1-12), human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C64H100N22O19SPeso molecular:1,513.7 g/molFmoc-Leu-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Leu-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%[D-Pro2]-beta-Casomorphin (1-5) , bovine, amide
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C30H38N6O6Peso molecular:578.7 g/molH-Phe-Val-OH
CAS:H-Phe-Val-OH, also known as humanized Val-Phe-His-Leu (VHL), is a monoclonal antibody that binds to the antigen epidermal growth factor (EGF). It has been shown to have diagnostic and therapeutic properties in vitro. This antibody is used in the diagnosis of cancer tissues and is able to identify carcinoma cell lines. Furthermore, it can be used to diagnose hepatitis C virus infection. H-Phe-Val-OH blocks the binding of EGF with its receptor on the surface of cells and prevents the proliferation of cancerous cells. It also inhibits cancer growth by reducing the synthesis of proteins such as epidermal growth factor and transforming growth factor alpha.Fórmula:C14H20N2O3Pureza:Min. 98%Forma y color:PowderPeso molecular:264.32 g/molH-Ile-Glu-OH
CAS:Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C11H20N2O5Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:260.29 g/molFmoc-D-Ser(BSi)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Ser(BSi)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H31NO5SiPureza:Min. 95%Peso molecular:441.59 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H24N2O6·C12H23NPureza:Min. 95%Peso molecular:497.67 g/molH-Arg(NO2)-OBzl p-tosylate salt
CAS:<p>Please enquire for more information about H-Arg(NO2)-OBzl p-tosylate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H19N5O4·C7H8O3SPureza:Min. 95%Forma y color:SolidPeso molecular:481.52 g/molFmoc-Leu-Gly-OH
CAS:Fmoc-Leu-Gly-OH is a dipeptide that is reversibly soluble in water and organic solvents. It has been found to be stable at millimeter and nanometer scales, which makes it suitable for use as a hydrogel or fiber. Fmoc-Leu-Gly-OH has also been shown to form membranes of variable thickness (from micrometers to nanometers) that are sensitive to pH changes. This means that the membrane can be used for sensing pH levels in a variety of environments. Dipeptides are amphiphiles, meaning they have both hydrophilic and lipophilic properties. This makes them useful for forming self-assembled structures, such as hydrogels and membranes, that are capable of transporting water molecules through the structure.Fórmula:C23H26N2O5Pureza:Min. 95%Forma y color:PowderPeso molecular:410.46 g/molH-SIYRYYGL-OH
<p>Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat)
CAS:Please enquire for more information about (Tyr0)-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C102H166N28O30S3Pureza:Min. 95%Peso molecular:2,360.78 g/molH-Ile-Met-OH
CAS:H-Ile-Met-OH is a cytosolic protein that is found in the cytosolic domain of plant cells. H-Ile-Met-OH is an enzyme that catalyzes the conversion of HMBP to Met, which is an intermediate in the biosynthesis of methionine. The frequency and sequence of H-Ile-Met-OH has been analyzed in animals, plants, and fungi. Bioinformatics studies have shown that H-Ile-Met-OH has a vacuolar function, which can be seen by its sequence similarity to other vacuolar proteins.Fórmula:C11H22N2O3SPureza:Min. 95%Peso molecular:262.37 g/molWRW4
CAS:<p>Please enquire for more information about WRW4 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C61H65N15O6Pureza:Min. 95%Peso molecular:1,104.27 g/molH-Ser-Glu-OH
CAS:<p>H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.</p>Fórmula:C8H14N2O6Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:234.21 g/mol([ring-D5]Phe8)-Angiotensin II acetate salt
CAS:<p>Please enquire for more information about ([ring-D5]Phe8)-Angiotensin II acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C50H66D5N13O12Pureza:Min. 95%Peso molecular:1,051.21 g/molAc-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond)
CAS:Please enquire for more information about Ac-Ala-Leu-Cys-Asp-Asp-Pro-Arg-Val-Asp-Arg-Trp-Tyr-Cys-Gln-Phe-Val-Glu-Gly-NH2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C97H139N27O29S2Pureza:Min. 95%Peso molecular:2,211.44 g/molEndothelin-1 (1-15), amide, human
<p>Catalogue peptide; min. 95% purity</p>Fórmula:C70H109N17O23S5Peso molecular:1,717.04 g/molLactoferricin B25
CAS:Lactoferricin B25 is a potent anticancer agent that has shown significant activity in vitro against cancer cell lines. It has been shown to induce apoptosis and autophagy, which are both methods of inducing cell death. Lactoferricin B25 also induces caspase-mediated apoptosis and has been shown to be effective in the treatment of cancer cells in vivo. Lactoferricin B25 binds with high affinity to the cell membrane, which is thought to be responsible for its anticancer activity. The half-maximal inhibitory concentration (IC50) for this compound is about 2 μM, with a concomitant cytotoxic effect at 10 μM. Lactoferricin B25 binds to DNA polymerase, preventing DNA replication and transcription. The binding of lactoferricin B25 to DNA polymerase inhibits the synthesis of RNA from DNA templates by inhibiting the elongation step of transcription.Fórmula:C141H224N46O29S3Pureza:Min. 90 Area-%Forma y color:PowderPeso molecular:3,123.78 g/molCJC-1295-no DAC acetate
CAS:CJC-1295-no DAC acetate is a synthetic peptide, which is a modified form of the growth hormone-releasing hormone (GHRH) analog, derived from recombinant sources. Its mode of action involves binding to the growth hormone secretagogue receptor, thereby promoting the release of growth hormone from the anterior pituitary. This mechanism of action facilitates the increase of circulating insulin-like growth factor 1 (IGF-1), enhancing various physiological processes.In scientific research, CJC-1295-no DAC acetate is primarily utilized to study its potential effects on muscle growth, body composition, and overall metabolic function. It is also used to explore its ability to modulate the aging process through growth hormone pathways. Unlike its counterpart with DAC, this variant has a shorter half-life, thus allowing researchers to examine the temporal effects of pulsatile GH release. Furthermore, its applications extend to understanding disorders related to growth hormone deficiencies, contributing valuable insights into therapeutic strategies for such conditions. The peptide serves as an important tool in endocrinology research, providing a platform for studying the complex interactions between hormonal regulation and physiological outcomes.DAC is 'drug affinity complex' and in this peptide works by not having a lysine at the end of the sequence.Fórmula:C152H252N44O42•(C2H4O2)xPureza:Min. 95%Peso molecular:3,367.9 g/molAmyloid beta-Protein (25-35) trifluoroacetate salt
CAS:<p>Amyloid beta-protein (Aβ) is a protein that is a major component of amyloid plaques in the brains of people with Alzheimer's disease. Aβ-Protein (25-35) trifluoroacetate salt, also known as Aβ(25-35), is an amyloid beta protein fragment that has been shown to inhibit neuronal death and increase antioxidative properties in human serum. It has been shown to have anti-apoptotic effects by inhibiting the activation of caspases and the release of cytochrome C from mitochondria. This drug may have physiological effects on the central nervous system due to its ability to induce apoptosis through mitochondrial membrane depolarization and cytosolic calcium levels. It has been shown to be active against Chinese herb Pueraria lobata and cell lysis, as well as granule neurons in culture. It may also stimulate phosphorylation of p38mapk and induce logarithmic growth</p>Fórmula:C45H81N13O14SPureza:Min. 95%Forma y color:PowderPeso molecular:1,060.27 g/molZ-Ala-Ala-Asn-AMC
CAS:Z-Ala-Ala-Asn-AMC is a molecule that is an analog of the amino acid alanine. It has been shown to be effective in inhibiting cancer cell viability and inducing apoptosis in MDA-MB-231 breast cancer cells, which can inhibit tumor growth. This molecule also inhibits protease activity, protein synthesis, and tubule cell proliferation. Z-Ala-Ala-Asn-AMC has applicability in the treatment of cancers and inflammatory diseases.Fórmula:C28H31N5O8Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:565.57 g/molH-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH
CAS:<p>Please enquire for more information about H-Glu(EDANS)-Pro-Leu-Phe-Ala-Glu-Arg-Lys(DABCYL)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C72H97N17O16SPureza:Min. 95%Peso molecular:1,488.71 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C54H85N19O13Pureza:Min. 95%Peso molecular:1,208.37 g/molFmoc-Asn(Trt)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:Min. 95%H-Leu-Arg-OH acetate salt
CAS:<p>H-Leu-Arg-OH acetate salt is a cyclase inhibitor that is used to treat cancer. It has been shown to inhibit soluble guanylate cyclase, which is an enzyme that converts guanosine triphosphate (GTP) into the second messenger molecule, cyclic guanosine monophosphate (cGMP). Inhibition of this enzyme results in a decrease in the production of cGMP and blood pressure. H-Leu-Arg-OH acetate salt also inhibits delta opioid receptors, which are found on the surface of cells in the brain. This drug binds competitively with delta opioid receptors and blocks the effect of endogenous or exogenous ligands such as enkephalins.</p>Fórmula:C12H25N5O3Pureza:Min. 95%Forma y color:PowderPeso molecular:287.36 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C247H361N57O80S2Pureza:Min. 95%Peso molecular:5,472.98 g/molH-Glu-Ala-OH
CAS:H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br> br>br> This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (Fórmula:C8H14N2O5Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:218.21 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C53H62N11O13PPureza:Min. 95%Peso molecular:1,092.1 g/molH-Asp-Gly-OH
CAS:<p>H-Asp-Gly-OH is a peptide hormone that belongs to the group of hydroxylated aspartic acid. This peptide hormone has been shown to be a lymphocyte transformation factor in vitro and stimulates the production of collagen and other proteins. It has also been shown to have anticarcinogenic effects on bone cancer cells, which may be due to its ability to induce apoptosis. H-Asp-Gly-OH has a neutral pH and forms stable complexes with metal ions, such as copper and zinc, which are important for a variety of biological functions.</p>Fórmula:C6H10N2O5Pureza:Min. 95 Area-%Forma y color:PowderPeso molecular:190.15 g/mol
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-4) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00833.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00839.webp&w=3840&q=75)
![[Lys15]-Amyloid beta-Protein (15-21)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00531.webp&w=3840&q=75)
![Autocamtide-3 [KKALHRQETVDAL]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00520.webp&w=3840&q=75)
![[D-Pro10]-Dynorphin A (1-11), porcine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00870.webp&w=3840&q=75)
![[Val35] -beta-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[Val5,Asn9]-Angiotensin I](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00346.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00489.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone [Met5, Pro6, D-Phe7, D-Trp9, Phe10] (5-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00606.webp&w=3840&q=75)
![[Arg91, Ala96]-MBP (87-99), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00795.webp&w=3840&q=75)
![[D-Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00838.webp&w=3840&q=75)
![[Leu144]-PLP (139-151), L144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00494.webp&w=3840&q=75)
![[Tyr12]-Somatostatin-28 (1-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00705.webp&w=3840&q=75)
![[Tyr0] Gastric Inhibitory Peptide (23-42), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00928.webp&w=3840&q=75)
![[Des-Leu26,Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00264.webp&w=3840&q=75)
![[Tyr4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00022.webp&w=3840&q=75)
![[Lys3, Phe10, Tyr13]-Autocamtide-2-Related Inhibitory Peptide (AIP) Analog](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00527.webp&w=3840&q=75)
![[Lys8,Asn9] Neurotensin LANT-6 (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00542.webp&w=3840&q=75)
![[Phe2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00173.webp&w=3840&q=75)
![[D-Cys6,Asn7,D-Ala11,Cys14]-Bombesin (6-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00137.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00348.webp&w=3840&q=75)
![[D-Pro2]-beta-Casomorphin (1-5) , bovine, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00842.webp&w=3840&q=75)
![([ring-D5]Phe8)-Angiotensin II acetate salt](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFR110025.webp&w=3840&q=75)
