Péptidos
Los péptidos son cadenas cortas de aminoácidos unidas por enlaces peptídicos, que desempeñan papeles importantes como moléculas biológicas en los procesos celulares. Funcionan como hormonas, neurotransmisores y moléculas de señalización, y se utilizan ampliamente en aplicaciones terapéuticas y diagnósticas. Los péptidos también son cruciales en la investigación para estudiar las interacciones de proteínas, actividades enzimáticas y vías de señalización celular. En CymitQuimica, ofrecemos una amplia selección de péptidos de alta calidad para apoyar sus necesidades de investigación y desarrollo en biotecnología y farmacéutica.
Subcategorías de "Péptidos"
Se han encontrado 30311 productos de "Péptidos"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Pteroylhexaglutamylglutamic acid
CAS:Pteroylhexaglutamylglutamic acid is a pteroylpolyglutamate.Fórmula:C49H61N13O24Pureza:98%Forma y color:SolidPeso molecular:1216.08AtPep3 TFA (902781-14-0 free base)
AtPep3 TFA is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.Fórmula:C104H179N36F3O34Pureza:98%Forma y color:SolidPeso molecular:2534.75EDC hydrochloride
CAS:Fórmula:C8H17N3·HClPureza:(HPLC) ≥ 98.0%Forma y color:White to off-white crystalline powderPeso molecular:191.70RI-STAD 2
AKAP disruptor binds PKA-RIα/β (KD 6.2/12.1nM), blocks AKAP interaction, inhibits type I PKA phosphorylation, cell-permeable.Fórmula:C109H181N25O35Pureza:98%Forma y color:SolidPeso molecular:2401.75Abecomotide
CAS:Abecomotide is a bioactive chemical.Fórmula:C45H79N13O16Pureza:98%Forma y color:SolidPeso molecular:1058.19Collagen type IV α1 (531-543)
CAS:Human COL4A1 gene on chromosome 13 encodes protein collagen IV α1 (531-543), a ubiquitous subunit important for angiogenesis.Fórmula:C74H110N18O21Pureza:98%Forma y color:SolidPeso molecular:1587.77Urocortin III, mouse TFA (357952-10-4 free base)
Urocortin III, a mouse peptide, activates CRF-R2, affecting stress response and social behavior in the medial amygdala.Fórmula:C188H313N52F3O54S2Pureza:98%Forma y color:SolidPeso molecular:4286.99A2-Binding peptide
CAS:A2-Binding peptide has involved in the assembly of MHC Class I molecules.Fórmula:C61H106N14O15Pureza:98%Forma y color:SolidPeso molecular:1275.602LXW7 TFA (1313004-77-1 free base)
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor with an anti-inflammatory effect.Fórmula:C31H49F3N12O14S2Pureza:98%Forma y color:SolidPeso molecular:934.92Myristoyl tripeptide-1
CAS:Myristoyl tripeptide-1 is a peptide.Fórmula:C28H50N6O5Pureza:98%Forma y color:SolidPeso molecular:550.73β-Endorphin, equine (TFA)
β-Endorphin, equine (TFA) is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors.Fórmula:C156H249F3N42O46SPureza:98%Forma y color:SolidPeso molecular:3537.96signal transducer and activator of transcription 6 fragment
The signal transducer and activator of transcription 6 fragments is a peptide with the sequence H2N-Ser-Tyr-Trp-Ser-Asp-Arg-Leu-Ile-Ile-OH, MW= 1152.3.Fórmula:C54H81N13O15Pureza:98%Forma y color:SolidPeso molecular:1152.3α-Factor Mating Pheromone, yeast (TFA)
The alpha factor pheromone arrests yeast in the G1 phase of their cell cycle.Fórmula:C84H115N20F3O19SPureza:98%Forma y color:SolidPeso molecular:1798.02[Glu1]-Fibrinopeptide B
CAS:<p>[Glu1]-Fibrinopeptide B, from human fibrinogen Bβ-chain (1-14), is created by thrombin and activates PMN, monocytes, fibroblasts.</p>Fórmula:C66H95N19O26Pureza:98%Forma y color:SolidPeso molecular:1570.6Locustatachykinin I
CAS:Insect tachykinin-related peptide (TRP)Fórmula:C43H63N13O11Pureza:98%Forma y color:SolidPeso molecular:938.04Z-Gly-Gly-Arg-AMC acetate
CAS:Z-Gly-Gly-Arg-AMC acetate is a thrombase-specific fluorescent matrix for the detection of thrombin production in PRP and poor platelet plasma (PPP).Fórmula:C30H37N7O9Pureza:98%Forma y color:SolidPeso molecular:639.66N-terminally acetylated Leu-enkephalin acetate
N-terminally acetylated Leu-enkephalin is the N-terminally acetylated form of Leu-enkephalin.Fórmula:C30H39N5O8Pureza:98%Forma y color:SolidPeso molecular:N/ABDNF (human)
CAS:<p>BDNF, a neurotrophin, activates TrkB/p75 receptors, aids neuron survival and growth, and is linked to Parkinson's and Alzheimer's.</p>Pureza:98%Forma y color:SolidPeso molecular:26984Fmoc-L-Proline
CAS:<p>Fmoc-L-Proline (Fmoc-Pro-OH) is a proline derivative.</p>Fórmula:C20H19NO4Pureza:99.22%Forma y color:SolidPeso molecular:337.37LCMV gp33-41 acetate
LCMV gp33-41 acetate is a sequence of lymphocytic choriomeningitis virus which restricted by major histocompatibility complex class I H-2Db and presented toFórmula:C50H77N11O15SPureza:95.93%Forma y color:SolidPeso molecular:1104.28[Pro3]-GIP (Mouse) acetate
[Pro3]-GIP (Mouse) acetate is mouse [Pro3]-GIP. [Pro3]-GIP is a GIP receptor antagonist.Fórmula:C227H346N62O66SPureza:95.31%Forma y color:SoildPeso molecular:5028.53Protein kinase inhibitor peptide
CAS:<p>Protein kinase inhibitor peptide matches the inhibitory domain of the heat-stable protein kinase inhibitor.</p>Fórmula:C84H136N28O27Pureza:98%Forma y color:SolidPeso molecular:1970.15Nph-peptide
CAS:Nph-peptide can be used for photoaffinity labeling of the N-formyl peptide receptor site of intact human polymorphonuclear leukocytes.Fórmula:C55H78N12O12Pureza:98%Forma y color:SolidPeso molecular:1099.28Lophyrotomin
CAS:Lophyrotomin is a hepatotoxin isolated from the European Birch sawfly Arge pullata.Fórmula:C48H65N9O17Pureza:98%Forma y color:SolidPeso molecular:1040.08Gly-Phe-Arg
CAS:Gly-Phe-Arg is a highly potent synthetic tripeptide that mimics the pumping pheromone of the mud-crab.Fórmula:C17H26N6O4Pureza:98%Forma y color:SolidPeso molecular:378.43Human IgE Pentapeptide HEPP acetate
Human IgE Pentapeptide HEPP acetate is a pentapeptide that does not produce IgE inhibition in several different systems and is used in the treatment ofFórmula:C24H39N8O13Pureza:97.90%Forma y color:SoildPeso molecular:647.61Tanurmotide
CAS:<p>Tanurmotide is a bioactive chemical.</p>Fórmula:C51H80N14O15SPureza:98%Forma y color:SolidPeso molecular:1161.33HIV-1 TAT 48-60
HIV-1 TAT (48-60) is a cell-penetrating peptide from HIV-1 Tat protein residues 48-60.Fórmula:C70H131N35O16Pureza:98%Forma y color:SolidPeso molecular:1719Fibronectin Adhesion-promoting Peptide
CAS:Heparin-binding peptide aids adhesion, part of fibronectin's carboxy-terminal domain.Fórmula:C47H74N16O10Pureza:98%Forma y color:SolidPeso molecular:1023.19NY-BR-1 p904 (A2)
CAS:T-cell clones specific for this NY-BR-1 epitope (p904) can recognize breast tumor cells expressing NY-BR-1.Fórmula:C43H78N10O15Pureza:98%Forma y color:SolidPeso molecular:975.14Peptide YY (PYY) (3-36), human TFA
Peptide YY (PYY) (3-36), human (TFA) is a gut hormone peptide that acts as a Y2 receptor agonist to reduce appetite[1].Fórmula:C176H272N52O54·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:4094.44SV40 T-Ag-derived NLS peptide
CAS:This peptide, a nuclear localization signal DNA tagged to this peptide efficiently translocates into the cell nucleus.Fórmula:C66H111N19O18SPureza:98%Forma y color:SolidPeso molecular:1490.77G280-9
CAS:G280-9 peptide: melanoma epitope for HLA-A2; recognized by T cells at low levels; low immunogenicity due to weak HLA-A2 affinity.Fórmula:C44H67N9O14Pureza:98%Forma y color:SolidPeso molecular:946.05Arthrofactin
CAS:Arthrofactin is a lipopeptide biosurfactant.Fórmula:C64H111N11O20Pureza:98%Forma y color:SolidPeso molecular:1354.649Neuromedin U, rat TFA (117505-80-3 free base)
Neuromedin U, rat TFA is a 23-amino acid brain-gut peptide.Fórmula:C126H181N34F3O33Pureza:98%Forma y color:SolidPeso molecular:2756.99Flagelin 22 TFA (304642-91-9 free base)
<p>Flagelin 22 TFA (Flagellin 22 TFA), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae.</p>Fórmula:C95H163F3O36N32Pureza:98%Forma y color:SolidPeso molecular:2386.53HPV16 E7 (86-93) acetate
HPV16 E7 (86-93) acetate is a derived peptide of human leukocyte antigen A2.1 restricted HPV16 E7 with immunogenic property in cervical carcinomas.Fórmula:C39H70N8O12SPureza:96.9100%Forma y color:SolidPeso molecular:875.08Acetyl tetrapeptide-9
CAS:Acetyl tetrapeptide-9 is important for the stimulation of basement membrane polysaccharide (lumican) and the synthesis of collagen I.Fórmula:C22H33N7O9Pureza:98%Forma y color:SolidPeso molecular:539.54Latromotide
CAS:<p>Latromotide is an antineoplastic agent.</p>Fórmula:C60H105N17O12Pureza:98%Forma y color:SolidPeso molecular:1256.58GRGDSPC
CAS:GRGDSPC: 7-AA thiolated peptide; non-viral gene vector; easy synthesis; high efficiency; low toxicity.Fórmula:C25H42N10O11SPureza:98%Forma y color:SolidPeso molecular:690.73TCS 183
competitive inhibitor of GSK-3β (Ser9) phosphorylationFórmula:C58H96N20O20SPureza:98%Forma y color:SolidPeso molecular:1425.58Bacterial Sortase Substrate III, Abz/DNP (TFA)
<p>Abz/DNP TFA is a quenched fluorescent peptide, cleaved by SrtA in Staphylococcus aureus, forming amide bonds in cell walls.</p>Fórmula:C43H58N11F3O16Pureza:98%Forma y color:SolidPeso molecular:1042.02TAT-DEF-Elk-1 TFA (1220751-16-5 free base)
TAT-DEF-Elk-1 TFA: a peptide that inhibits Elk-1, blocking its phosphorylation and nuclear entry, without affecting ERK/MSK1.Fórmula:C157H260N57F3O42Pureza:98%Forma y color:SolidPeso molecular:3675.09TAT TFA (191936-91-1 free base)
<p>TAT TFA (YGRKKRRQRRR) is derived from human immunodeficiency virus (hiv-1) transcription reverse activator TAT, is a cell penetrating peptide.</p>Fórmula:C66H119N32F3O16Pureza:98%Forma y color:SolidPeso molecular:1673.85Flagelin 22 acetate
Flagelin 22 acetate is part of the bacterial flagellin family and is an effective inducer in plants and algae.Fórmula:C95H166N32O36Pureza:95.93%Forma y color:SolidPeso molecular:2332.56TLQP-30
CAS:TLQP-21 peptide boosts metabolism, regulates temperature, and counters high-fat diet weight/hormonal effects in mice.Fórmula:C150H232N54O40Pureza:98%Forma y color:SolidPeso molecular:3431.78Dynorphin A (1-10) TFA(79994-24-4,free)
Dynorphin A (1-10) (TFA), an endogenous opioid neuropeptide, binds in the transmembrane domain of the κ-receptor.Fórmula:C59H92F3N19O14Pureza:98%Forma y color:SolidPeso molecular:1348.48Kv3, Channel Containing Protein 567-585
Kv3.1b channel protein, in PV+ pallidal neurons, spans amino acids 567-585.Fórmula:C93H156N24O28S2Pureza:98%Forma y color:SolidPeso molecular:2122.5GLP-1(32-36)amide acetate
<p>GLP-1(32-36)amide acetate, a pentapeptide from GLP-1, inhibits weight gain and regulates glucose in diabetic mice.</p>Fórmula:C27H54N10O7Pureza:97.93%Forma y color:SoildPeso molecular:630.78hemagglutinin precursor (114-122) amide [Influenza A virus]
Partial antigenic glycoproteinFórmula:C53H68N10O16Pureza:98%Forma y color:SolidPeso molecular:1101.16MAGE-A3 (195-203)
CAS:MAGE-3/HLA-A24 is a strong MHC-binding peptide, promising for immunotherapy in MAGE-3+ tumors.Fórmula:C45H82N10O10SPureza:98%Forma y color:SolidPeso molecular:955.3Tyroserleutide TFA (138168-48-6 free base)
Tyroserleutide TFA: a tripeptide from porcine spleen; inhibits tumor growth in vitro/in vivo.Fórmula:C20H28F3N3O8Pureza:98%Forma y color:SolidPeso molecular:495.45Pep1-TGL
Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunitFórmula:C41H71N11O15SPureza:98%Forma y color:SolidPeso molecular:990.14M-2420
CAS:<p>M-2420 is a fluorogenic substrate designed specifically for the β-secretase site found in the Swedish mutation of the amyloid precursor protein (APP).</p>Fórmula:C70H91N15O27Pureza:98%Forma y color:SolidPeso molecular:1574.56Nitric Oxide Synthase (599-613) Blocking Peptide, Bovine Endothelial Cell
Blocker of bovine endothelial NOS (599-613), inhibits NO production, useful in managing ischemic injury and inflammation.Fórmula:C85H127N25O27SPureza:98%Forma y color:SolidPeso molecular:1963.13Trempamotide
CAS:Trempamotide is a bioactive chemical.Fórmula:C58H80N10O18Pureza:98%Forma y color:SolidPeso molecular:1205.31WT-1 A1
CAS:WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.Fórmula:C55H74N10O13SPureza:98%Forma y color:SolidPeso molecular:1115.3TAK-683 TFA (872719-49-8 free base)
TAK-683 TFA: potent KISS1R agonist (IC50: 170 pM, EC50: 0.96 nM human, 1.6 nM rat), metabolically stable.Fórmula:C66H84F3N17O15Pureza:98%Forma y color:SolidPeso molecular:1412.47Conotoxin GII
CAS:Conotoxin GII is a highly toxic peptide.Fórmula:C57H81N19O16S4Pureza:98%Forma y color:SolidPeso molecular:1416.63OVA sequence (323-336)
CAS:This peptide is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogencityFórmula:C63H100N20O22Pureza:98%Forma y color:SolidPeso molecular:1489.59vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]
Vitamin D-binding protein transports vitamin D, has immune roles, is highly polymorphic, and responds to dietary strontium.Fórmula:C54H95N17O17Pureza:98%Forma y color:SolidPeso molecular:1254.44Crustacean Cardioactive Peptide Acetate
CCAP acetate, a widespread neuropeptide in arthropods, is a cyclic hormone produced in insect neurons.Fórmula:C44H62N10O14S2Pureza:99.56%Forma y color:SolidPeso molecular:1019.15β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Fórmula:C49H76N12O15Pureza:98%Forma y color:SolidPeso molecular:1073.2Exendin-4 peptide derivative
Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.Pureza:98%Forma y color:SolidPeso molecular:3692.15cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Fórmula:C126H202N42O40S2Pureza:98%Forma y color:SolidPeso molecular:3009.36D-Lys(Z)-Pro-Arg-pNA
CAS:D-Lys(Z)-Pro-Arg-pNA is a luminescent substrate of activated protein C (APC).Fórmula:C31H43N9O7Pureza:98%Forma y color:SolidPeso molecular:653.73Prion Protein 106-126 (human)
CAS:Prion peptide fragment that exhibits neurotoxicityFórmula:C80H138N26O24S2Pureza:98%Forma y color:SolidPeso molecular:1912.24type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).Fórmula:C47H77N13O15Pureza:98%Forma y color:SolidPeso molecular:1064.19Ige octapeptide (497-504)
CAS:Ige octapeptide (497-504) is a bioactive chemical.Fórmula:C41H63N11O10Pureza:98%Forma y color:SolidPeso molecular:870.01HIF-1 α (556-574) TFA (1201633-99-9 free base)
19-mer HIF-1α fragment critical for oxygen response; binds VHL via crucial proline 564 for gene regulation.Fórmula:C103H151D2F3N20O36S2Pureza:98%Forma y color:SolidPeso molecular:2368.62NP213 TFA (942577-31-3 free base)
NP213 TFA: first synthetic AMP with fast-acting anti-fungal action, disrupts fungal membranes.Fórmula:C44H85F3N28O9Pureza:98%Forma y color:SolidPeso molecular:1207.32immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]
Human and mouse Ig light chain variable region fragment binds antigens; part of B cell Ig molecule with heavy and light chains.Fórmula:C54H83N13O13Pureza:98%Forma y color:SolidPeso molecular:1122.32Substance P acetate
Substance P acetate is a peptide mainly secreted by neurons and is involved in many biological processes including nociception and inflammation.Fórmula:C65H102N18O15SPureza:98.81%Forma y color:SolidPeso molecular:1407.68α-Conotoxin Vc1.1 TFA
α-Conotoxin Vc1.1 TFA is a peptide isolated from Conus victoriae and is also a nAChR antagonist that can be used to study neuropathic chronic pain.Fórmula:C73H108F3N23O27S4Pureza:97.57%Forma y color:SolidPeso molecular:1925.03Human PD-L1 inhibitor V
CAS:Human PD-L1 Inhibitor V is a peptide that binds to the human PD-1 protein with an affinity characterized by a dissociation constant (Kd) of 3.32 μM, effectivelyFórmula:C65H104N20O18SPureza:98%Forma y color:SolidPeso molecular:1485.71IGF-I (24-41) TFA (135861-49-3 free base)
IGF-I (24-41) (TFA) is a fragment of IGF-I with anabolic, antioxidant, anti-inflammatory, and cytoprotective properties.Fórmula:C88H133N27O28·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:2131.18Somatostatin-28 (1-12)
CAS:Somatostatin-28 (1-12) is a somatostatin fragment which is monitored in brain tissue to track processing of somatostatin.Fórmula:C49H81N17O19SPureza:98%Forma y color:SolidPeso molecular:1244.33BDC2.5 mimotope 1040-51
CAS:BDC2.5 mimotope 1040-51 is an agonistic peptide for T cells in diabetic NOD mice.Fórmula:C60H99N17O13SPureza:98%Forma y color:SolidPeso molecular:1298.6Proadrenomedullin (45-92), human
CAS:Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM.Fórmula:C215H359N67O73S2Pureza:98%Forma y color:SolidPeso molecular:5114.76Adrenomedullin (AM) (1-52), human
CAS:Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide that modulates cellular proliferation and angiogenesis in cancer.Fórmula:C264H406N80O77S3Pureza:98%Forma y color:SolidPeso molecular:6028.82KKI-5 TFA(97145-43-2 free base)
KKI-5 (TFA) is a specific tissue kallikrein inhibitor.Kki-5 (TFA) can reduce breast cancer cell infiltration.Fórmula:C37H56F3N11O11Pureza:98%Forma y color:SolidPeso molecular:887.9Fibrinopeptide A, human
CAS:Human Fibrinopeptide A: 16-residue peptide from fibrinogen's Aα region, cleaved by thrombin.Fórmula:C63H97N19O26Pureza:98%Forma y color:White Lyophilized PowderPeso molecular:1536.56S-palm P0(180-199) TFA
S-palm P0(180–199) (TFA) is a peptide that enhances MHC II-restricted responses. It is utilized to develop models of chronic inflammatory demyelinating polyradiculoneuropathy (CIDP) and chronic experimental autoimmune neuritis (c-EAN). S-palm P0(180–199) (TFA) is also studied in the context of autoimmune-mediated neuritis.Fórmula:C112H191N33O29S2·xC2HF3O2Forma y color:SolidPeso molecular:2528.05 (free base)PD-1/PD-L1 inhibitory peptide C8
PD-1/PD-L1 inhibitory peptide C8 disrupts the PD-1/PD-L1 interaction, leading to the activation of CD8+ and CD4+ T cells and an increase in IFN-γ secretion. In mouse models, PD-1/PD-L1 inhibitory peptide C8 has demonstrated antitumor activity.Fórmula:C51H72N14O14S2Forma y color:SolidPeso molecular:1169.33Microcystin YR
CAS:Microcystin YR (Cyanoginosin YR) is a cyclic peptide and acts as an inhibitor of protein phosphatase 2A (PP2A).Fórmula:C52H72N10O13Forma y color:SolidPeso molecular:1045.19Valylvaline
CAS:Valylvaline (Val-val) is a dipeptide compound that can be used for protein synthesis.Fórmula:C10H20N2O3Pureza:99.67%Forma y color:SolidPeso molecular:216.28p21PBP
p21PBP, a peptide composed of 20 amino acids, serves as an inhibitor of DNA replication. It specifically binds to the purified proliferating cell nuclear antigen (PCNA) found in extracts from tumor cells. p21PBP holds potential for use in cancer research.Fórmula:C112H181N37O30SForma y color:SolidPeso molecular:2557.93Thanatin acetate
Thanatin acetate is a cationic peptide with antimicrobial activity, inhibiting bacterial and fungal growth.Fórmula:C105H181N35O29S3Pureza:99.65%Forma y color:SolidPeso molecular:2493.97PIC1 PA
CAS:PIC1 PA, a peptide consisting of 15 amino acids, serves as an effective analog of PIC1 that inhibits complement activation mediated by the classical pathway. Functionally, PIC1 PA interferes with the interaction between the C1s-C1r-C1r-C1s/MASPs and the collagen-like region (CLR) of C1q/MBL. It specifically binds to the CLR of C1q, with an average equilibrium dissociation constant (KD) of 33.3 nM when binding purified C1q.Fórmula:C71H123N19O21S2Forma y color:SolidPeso molecular:1642.98ACTH 4-11 acetate
ACTH 4-11 acetate, a fragment of adrenocorticotropin, matches α-MSH's sequence and has weak MSH potency at high doses (100-1000 nM).Fórmula:C52H75N15O13SPureza:99.21%Forma y color:SolidPeso molecular:1150.31Nucleoprotein (118-126)
CAS:Nucleoprotein (118-126),a fragment of Nucleoprotein, is a 9-aa peptide .Fórmula:C43H69N13O13SPureza:98%Forma y color:SolidPeso molecular:1008.15Z-AEVD-FMK
CAS:Z-AEVD-FMK (Z-Ala-Glu-Val-Asp-Fluoromethyl Ketone) is a degradable ADC linker and a caspase-10 inhibitor, reducing TNF-α/butyrate-induced cell apoptosis.Fórmula:C28H39FN4O10Forma y color:SolidPeso molecular:610.63Nictide
CAS:<p>Nictide, a peptide substrate for LRRK2 (leucine-rich repeat protein kinase-2), undergoes phosphorylation by the activated form of LRRK2[G2019S], exhibiting a Km value of 10 μM.</p>Fórmula:C123H193N45O28Forma y color:SolidPeso molecular:2750.13pYEEI
<p>pYEEI, a tetrapeptide containing phosphotyrosine, binds to the SrcSH2 domain with a dissociation constant (Kd) of 100 nM and an inhibitory concentration (IC50) of 6.5 μM. This compound plays a crucial role in cancer research.</p>Fórmula:C25H36N3O14PForma y color:SolidPeso molecular:633.54Maurocalcine TFA
Maurocalcine TFA acts as an agonist for ryanodine receptor (RyR) channels 1, 2, and 3, demonstrating cell-penetrating capabilities. It induces binding of [3H]ryanodine to RyR1 with an EC50 of 2558 nM and exhibits an apparent affinity of 14 nM for RyR2. This compound is applicable for in vivo cell tracking or other cellular imaging techniques.Fórmula:C156H270N56O46S6·xC2HF3O2Forma y color:SolidPeso molecular:3858.55 (free base)AtPep3
CAS:AtPep3 is a hormone-like peptide that plays a role in the salinity stress tolerance of plants.Fórmula:C102H178N36O32Pureza:98%Forma y color:SolidPeso molecular:2420.73Iso-VQA-ACC acetate
Iso-VQA-ACC acetate serves as a substrate for the constitutive proteasome.Forma y color:Odour Solid6-FAM-AEEAC-SHK TFA
6-FAM-AEEAC-SHK TFA, a peptide neurotoxin derived from Stichodactyla helianthus and conjugated with a fluorescent marker, selectively blocks voltage-gated potassium channels (kv1.1 and kv1.2). By prolonging action potentials, it interferes with neural signal conduction, making it valuable in neuroscience research.Fórmula:C196H295N55O57S7·xCHF3O2Forma y color:SolidPeso molecular:4558.23 (free acid)WL47 TFA
WL47 TFA is a selective small molecule caveolin-1 oligomer disruptor that disrupts CAV1 oligomers.Fórmula:C76H119F3N22O18S4Pureza:99.80%Forma y color:SolidPeso molecular:1814.16FBN33428
CAS:FBN33428, also referred to as Fmoc-Phe-Lys(Boc)-PAB, is a hydrolyzable linker utilized in the synthesis of antibody-drug conjugates (ADCs). This compound facilitates the creation of hydrolyzable prodrugs, enhancing the targeted delivery of anticancer drugs to metastatic cells.Fórmula:C42H48N4O7Forma y color:SolidPeso molecular:720.87µ-Conotoxin-CnIIIC acetate
µ-Conotoxin-CnIIIC acetate is a NaV1.4 sodium channel antagonist, a conotoxin peptide consisting of 22 amino acids, used for muscle relaxation and pain relief.Fórmula:C92H139N35O28S6·xC2H4O2Pureza:99.94%Forma y color:SolidPeso molecular:2375.70 (free base)Angiotensin 1/2 (1-8) amide
Angiotensin 1/2 amide, a vasopressor and potent vasoconstrictor, treats shock and circulatory collapse.Fórmula:C50H72N14O11Pureza:98%Forma y color:SolidPeso molecular:1045.19N-Oleoyl Valine Ammonium salt
N-Oleoyl Valine Ammonium salt is an N-acyl amide compound that is a TRPV3 antagonist and can be used to study inflammation.Fórmula:C23H46N2O3Pureza:99.72%Forma y color:SolidPeso molecular:398.62heparin cofactor II precursor fragment [Homo sapiens]
Heparin cofactor II precursor fragment [Homo sapiens] is a peptide with the sequence H2N-Tyr-Glu-Ile-Thr-Thr-Ile-His-Asn-Leu-Phe-Arg-OH, MW=1406.58.Fórmula:C65H99N17O18Pureza:98%Forma y color:SolidPeso molecular:1406.58Biotin-SRC-1 (676-700) TFA
Biotin-SRC-1 (676–700), a biotinylated and truncated variant of steroid receptor coactivator 1 (SRC-1), finds application in affinity-based reporter assays suchFórmula:C128H209N41O40S2·XCF3COOHForma y color:SolidPeso molecular:3026.41Boc-Glu(OBzl)-OH
CAS:Boc-Glu(OBzl)-OH (Boc-Glu(OBzl)-OH) is an Glutamic acid derivative.Fórmula:C17H23NO6Pureza:98.11%Forma y color:SolidPeso molecular:337.37Bio-Ben
Bio-ben functions as a sulfenic acid probe, utilized for labeling both free sulfenic acid and cysteine sulfenic acid within proteins and peptides.Fórmula:C17H22BN3O4SForma y color:SolidPeso molecular:375.20Conopressin S
CAS:Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM.Fórmula:C41H73N17O10S2Pureza:98%Forma y color:SolidPeso molecular:1028.26Cardiotoxin Analog (CTX) IV (6-12)
CAS:Cardiotoxin Analog (CTX) IV (6-12) is a part peptide of Cardiotoxin Analog (CTX) IV. Cardiotoxin analogues IV isolated from the venom of Taiwan Cobra.Fórmula:C48H70N10O7Pureza:98%Forma y color:SolidPeso molecular:899.13Amyloid Precursor C-Terminal Peptide
Amyloid precursor peptide involved in Alzheimer's forms plaques; sequence Gly-Tyr-Glu-Asn-Pro-Thr-Y-Lys-Phe-F-Glu-Gln-M-Gln-Asn. Linked to astrocytosis.Fórmula:C86H118N20O27S1Pureza:98%Forma y color:SolidPeso molecular:1896.04Bam 12P acetate
Bam 12P acetate is the putative enkephalin precursor in bovine adrenal, pituitary, and hypothalamus.Fórmula:C64H101N21O18SPureza:98.84%Forma y color:SolidPeso molecular:1484.68Z-Asp(OBzl)-OH
CAS:Z-Asp(OBzl)-OH (N-Cbz-L-Aspartic acid 4-benzyl ester) is an aspartic acid derivative.Fórmula:C19H19NO6Pureza:98.71%Forma y color:SolidPeso molecular:357.36ACTH (1-17) (TFA) (7266-47-9 free base)
<p>ACTH (1-17) TFA is a corticotrophin analogue and an effective human melanocortin 1 (MC1) receptor agonist with Ki value of 0.21 nM.</p>Fórmula:C95H145N29O23S·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:2207.43Beefy meaty peptide
CAS:Beefy meaty peptide is a bioactive chemical.Fórmula:C34H57N9O16Pureza:98%Forma y color:SolidPeso molecular:847.87Ziptide TFA
Ziptide, a peptide substrate, is recognized by several serine/threonine protein kinases, such as MAPK activated protein kinase 2 (MAPKAPK2), MAPKAPK3, MAPKAPK5Fórmula:C65H109N19O19·XCF3COOHForma y color:SolidPeso molecular:1460.70SNAP8
CAS:SNAP8 (Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-Nh2) is a mimic of the N-terminal end of SNAP-25 which competes with SNAP-25 for a position in the SNARE complex,Fórmula:C41H70N16O16SPureza:98%Forma y color:SolidPeso molecular:1075.16Pentapeptide-4
CAS:Pentapeptide-4 is a matrikine utilized in anti-wrinkle cosmetics.Fórmula:C23H45N7O9Pureza:98%Forma y color:SolidPeso molecular:563.64Iberiotoxin TFA
Iberiotoxin (TFA) is a selective inhibitor of high conductance Ca2+-activated K+ channels, exhibiting a dissociation constant (Kd) of approximately 1 nM, yet itFórmula:C179H274N50O55S7·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:4230.85 (free base)Dc1a
Dc1a, a toxin isolated from the desert bush spider Diguetia canities [1], potently facilitates the opening of the German cockroach Na v channel (BgNa v 1).Fórmula:C276H414N76O84S8Pureza:98%Forma y color:SolidPeso molecular:6397.22Davunetide acetate
<p>Davunetide acetate is derived from activity-dependent neuroprotective protein existing in the mammalian CNS.</p>Fórmula:C38H64N10O14Pureza:99.52% - 99.78%Forma y color:SolidPeso molecular:884.97SYSMEHFRWGKPS
<p>SYSMEHFRWGKPS is a 13-amino acid peptide.</p>Fórmula:C73H102N20O20SPureza:98%Forma y color:SolidPeso molecular:1611.81Enhanced Green Fluorescent Protein (EGFP) (200-208)
CAS:Enhanced Green Fluorescent Protein (200-208) (EGFP (200-208)) is a peptide that strongly binds to H2-K, a restricted cytotoxic T lymphocyte (CTL) epitope.Fórmula:C45H70N12O15Pureza:98.54% - 99.85%Forma y color:SolidPeso molecular:1019.11κM-Conotoxin RIIIK
CAS:κM-Conotoxin RIIIK is a potassium channel antagonist that inhibits voltage-activated potassium ion channels [1].Fórmula:C106H178N34O33S6Pureza:98%Forma y color:SolidPeso molecular:2649.1516-38-Thymosin β4 (cattle) (TFA)
Thymosin β4 (cattle) TFA is a high-affinity activator of MLCK that operates independently of Ca2+ [1].Fórmula:C120H205F3N32O43Pureza:98%Forma y color:SolidPeso molecular:2841.1C-Reactive Protein (CRP) (77-82)
CAS:<p>CRP 77-82 is a fragment of CRP, a pentameric, plasma protein that marks inflammation and cardiovascular risk, rising with IL-6 from macrophages/T cells.</p>Fórmula:C23H40N6O10Pureza:98%Forma y color:SolidPeso molecular:560.61Sphistin Synthetic Peptide
Sphistin peptide (12-38, FITC-labeled N-terminus) is a potent antimicrobial truncated fragment.Fórmula:C159H250N50O37SPureza:98%Forma y color:SolidPeso molecular:3486.06Acyl Carrier Protein (ACP) (65-74)
CAS:ACP (65-74) is a plastidial fatty acid synthetase fragment binding acyl groups with 4-phosphopantetheine.Fórmula:C47H74N12O16Pureza:98%Forma y color:SolidPeso molecular:1063.16SIYRY
CAS:SIYRY is a Kb-restricted epitope peptide.Fórmula:C50H71N11O13Pureza:98%Forma y color:SolidPeso molecular:1034.16Cholecystokinin pentapeptide
CAS:Cholecystokinin pentapeptide is a peptide hormone of the gastrointestinal system responsible for stimulating the digestion of fat and protein.Fórmula:C31H39N7O7SPureza:98%Forma y color:SolidPeso molecular:653.75Sperm acrosomal peptide P23
CAS:Sperm acrosomal peptide P23 is a peptide obtained from sperm acrosomal protein.Fórmula:C31H59N9O7Pureza:98%Forma y color:SolidPeso molecular:669.86HBcAg [Hepatitis B virus] (18-27)
HBcAg indicates active Hep B replication—suggests high transmission risk.Fórmula:C58H78N10O15Pureza:98%Forma y color:SolidPeso molecular:1155.3N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys
CAS:N-Formyl-Nle-Leu-Phe-Nle-Tyr-Lys TFA is a formyl peptide receptor (FPR) agonist.Fórmula:C43H65N7O9Pureza:98%Forma y color:White PowderPeso molecular:824.02Pseudo RACK1
Protein kinase C activator linked to Antennapedia domain for cell entry; ensures quick uptake and intracellular release.Fórmula:C144H225N43O34S3Pureza:98%Forma y color:SolidPeso molecular:3198.81Thrombin receptor peptide ligand
CAS:Thrombin receptor peptide ligand, a thrombin receptor antagonist, serves as an antithrombotic agent [1].Fórmula:C33H54N10O8Pureza:98%Forma y color:SolidPeso molecular:718.84RGD peptide (GRGDNP) (TFA) (114681-65-1 free base)
RGD peptide (GRGDNP) (TFA) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.Fórmula:C25H39F3N10O12Pureza:98%Forma y color:SolidPeso molecular:728.63Cerebellin
CAS:Cerebellin: 16-amino acid peptide, from rat cerebellum, now found in human adrenal glands, mainly medullary chromaffin cells.Fórmula:C69H113N23O23Pureza:98%Forma y color:SolidPeso molecular:1632.78Bacterial Sortase Substrate III, Abz/DNP
<p>Sortase A binds virulence proteins to Staphylococcus aureus cell walls, targeting LPXTG motif, cleaves, and catalyzes amide bonds in substrates.</p>Fórmula:C41H57N11O14Pureza:98%Forma y color:SolidPeso molecular:928MARCKS Peptide(151-175), Phosphorylated
<p>Myristoylated Alanine-Rich C Kinase Substrate peptide (151-175) is a high affinity Protein Kinase C substrate.</p>Fórmula:C147H246N41O40P3Pureza:98%Forma y color:SolidPeso molecular:3320.8Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]
Cytochrome c: small heme protein, in mitochondria, has methylated lysines in some eukaryotes, crucial for Apaf-1 function.Fórmula:C50H80N12O13Pureza:98%Forma y color:SolidPeso molecular:1057.24EGFRvIII peptide PEPvIII acetate
EGFRvIII peptide PEPvIII acetate, a tumor-specific mutation, is prevalent in GBM and other cancers, increasing tumorigenicity.Fórmula:C72H115N19O26SPureza:96.21%Forma y color:SolidPeso molecular:1694.86Ref: TM-TP1589L
1mg185,00€5mg415,00€10mg622,00€25mg1.119,00€50mg1.679,00€100mg2.520,00€200mg3.780,00€PKC ζ pseudosubstrate
Inhibitor of protein kinase C (PKC) ζ; attached to cell permeabilisation Antennapedia domain vector peptide.Fórmula:C208H336N74O44S3Pureza:98%Forma y color:SolidPeso molecular:4673.59kCAL01
CAS:kCAL01 is a CAL inhibitor with a Ki value of 2.3 μM and holds potential for research in cystic fibrosis (CF).Fórmula:C36H57N11O9Forma y color:SolidPeso molecular:787.91eukaryotic translation initiation factor 3
<p>Eukaryotic initiation factors (eIF) are proteins involved in the initiation phase of eukaryotic translation.</p>Fórmula:C47H84N14O14SPureza:98%Forma y color:SolidPeso molecular:1101.32Cucumechinoside D
CAS:Cucumechinoside D is a natural bioactive chemical.Fórmula:C54H84O32S3Pureza:98%Forma y color:SolidPeso molecular:1341.41Xenin-8
CAS:<p>neurotensin-like peptide that modulate pancreatic insulin and glucagon secretion/effects</p>Fórmula:C51H79N15O9Pureza:98%Forma y color:SolidPeso molecular:1046.27Semax
CAS:Semax is a synthetic peptide analog of adrenocorticotropic hormone (ACTH) that has neuroprotective, analgesic, and anxiolytic properties.Fórmula:C37H51N9O10SPureza:98%Forma y color:SolidPeso molecular:813.93JAG-1, scrambled
CAS:This peptide is a scrambled sequence of JAG-1(188-204).Fórmula:C93H127N25O26S3Pureza:98%Forma y color:SolidPeso molecular:2107.35Biotin-myelin basic protein (94-102)
CAS:Biotin-myelin basic protein (94-102) is a peptide fragment crucial for myelin adhesion within the nervous system, facilitating myelination.Fórmula:C49H84N20O13SForma y color:SolidPeso molecular:1193.38Triletide
CAS:<p>Triletide is a thromboxane A2 antagonist agent.</p>Fórmula:C27H31N5O5Pureza:98%Forma y color:SolidPeso molecular:505.57D-loop peptide, synthetic
CAS:D-loop peptide, synthetic; antigenic; cycles via Asp10 side chain to terminal amide bond.Fórmula:C53H76N16O16SPureza:98%Forma y color:SolidPeso molecular:1225.35Cucumechinoside C
CAS:<p>Cucumechinoside C is a bioactive natural chemical.</p>Fórmula:C54H86O28S2Pureza:98%Forma y color:SolidPeso molecular:1247.37type II collagen fragment
Type II collagen, a triple helix of α chains, forms a fibril meshwork crucial in arthritides, with slow turnover in cartilage.Fórmula:C65H102N18O21Pureza:98%Forma y color:SolidPeso molecular:1471.61EGFR Peptide (human, mouse) TFA
EGFR peptide, a PKC peptide substrate, mirrors an amino acid sequence from EGFR's intracellular region and serves to gauge PKC activity in primary bovineFórmula:C46H91N21O10·XCF3COOHForma y color:SolidPeso molecular:1098.35Dynorphin (2-17), amide, porcine
Dynorphins, opioid peptides from prodynorphin, form upon cleavage by PC2 into dynorphin A, B, and α/β-neo-endorphin.Fórmula:C90H147N31O20Pureza:98%Forma y color:SolidPeso molecular:1983.33NF023 hexasodium
CAS:NF023 hexasodium is a selective and competitive P2X1 receptor antagonist, with IC50 values of 0.21 μM, 28.9 μM, > 50 μM and > 100 μM for human P2X1, P2X3, P2X2Fórmula:C35H26N4Na6O21S6Pureza:98%Forma y color:SolidPeso molecular:1168.92V5 Epitope Tag Peptide
V5 epitope: 95GKPIPNPLLGLDST108 from simian parainfluenza virus 5 polymerase α, chosen for its high-affinity antibody production.Fórmula:C64H108N16O20Pureza:98%Forma y color:SolidPeso molecular:1421.64CysHHC10 acetate
CysHHC10 acetate is antibacterial; MIC: E. coli 10.1mM, P. aeruginosa 20.2mM, S. aureus 2.5mM, S. epidermidis 1.3mM.Fórmula:C79H111N23O12SPureza:98.33%Forma y color:SolidPeso molecular:1606.94C3a (70-77) TFA (63555-63-5 free base)
C3a (70-77) TFA (Complement 3a (70-77) TFA) is a COOH-terminal fragment of the C3a anaphylatoxin peptide.Fórmula:C37H62F3N13O12Pureza:98%Forma y color:SolidPeso molecular:937.96mHuwentoxin-IV
mHuwentoxin-IV, a naturally modified form of Huwentoxin-IV, selectively inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels in dorsal rootFórmula:C174H276N52O50S6Pureza:98%Forma y color:SolidPeso molecular:4088.76C-Type Natriuretic Peptide (1-22) acetate(human)
CNP (1-22), human acetate, NPR-B agonist, inhibits cAMP synthesis, counters histamine and 5-HT effects.Fórmula:C97H162F3N27O32S3Pureza:95.95%Forma y color:SolidPeso molecular:2371.68Tamapin
Tamapin, a venom peptide isolated from the Indian red scorpion (Mesobuthus tamulus) [1], selectively targets and blocks small-conductance Ca(2+)-activated KFórmula:C146H238N44O41S6Pureza:98%Forma y color:SolidPeso molecular:3458.11REDV TFA
REDV TFA, the minimal active sequence of the CS5 site in the alternatively spliced type III connecting segment (IIICS) of fibronectin, mediates adhesion to theFórmula:C20H35N7O9·xC2HF3O2Pureza:98%Forma y color:SolidPeso molecular:517.53 (free acid)Jingzhaotoxin XI
Jingzhaotoxin XI (JZTX-XI) is a potent inhibitor of sodium conductance, exhibiting an IC50 value of 124 nM, and notably retards the rapid inactivation of Na_v1.Fórmula:C158H234N44O47S7Pureza:98%Forma y color:SolidPeso molecular:3726.27Jingzhaotoxin-34
Jingzhaotoxin-34, a 35-residue neurotoxic polypeptide, selectively inhibits tetrodotoxin-sensitive (TTX-S) sodium currents in rat dorsal root ganglion neuronsFórmula:C154H219N39O45S7Pureza:98%Forma y color:SolidPeso molecular:3561.08ShK toxin
CAS:ShK toxin, isolated from the Caribbean sea anemone (Stichodactyla helianthus), is an inhibitor of the voltage-dependent potassium channel (Kv1.3 channel).Fórmula:C169H274N54O48S7Pureza:98%Forma y color:SolidPeso molecular:4054.8Spaglumic acid acetate
Spaglumic acid acetate (Isospaglumic acid acetate) is a neuropeptide found in millimolar concentrations in brain.Fórmula:C13H20N2O10Pureza:99.49%Forma y color:SolidPeso molecular:364.31Uty HY Peptide (246-254)
CAS:Uty HY Peptide (246-254) is a male-specific antigen from Y chromosome H-YDB gene.Fórmula:C53H77N15O13S2Pureza:98%Forma y color:SolidPeso molecular:1196.4Kisspeptin 10 (dog)
Endogenous canine KISS1 receptor ligand; boosts LH, FSH, estradiol secretion.Fórmula:C65H87N17O14Pureza:98%Forma y color:SolidPeso molecular:1330.51ε-V1-2, Cys-conjugated
Epsilon-V1-2, a Cys-conjugated, is a biologically active peptide known as the εPKC-specific inhibitor.Fórmula:C40H70N10O14SPureza:98%Forma y color:SolidPeso molecular:947.11Tos-Gly-Pro-Arg-ANBA-IPA
CAS:Tos-Gly-Pro-Arg-ANBA-IPA: a substrate for rapid hirudin assay.Fórmula:C30H41N9O8SPureza:98%Forma y color:SolidPeso molecular:687.77Myr-TAT-CBD3
Myr-TAT-CBD3, a CRMP2-CaV2.2 interaction inhibitor, has been shown to significantly attenuate carrageenan-induced thermal hypersensitivity and reverse thermalFórmula:C148H269N59O33Pureza:98%Forma y color:SolidPeso molecular:3403.09µ-Conotoxin BuIIIB
CAS:<p>μ-Conotoxin BuIIIB (Mu-Conotoxin BuIIIB), a selective blocker of mammalian neuronal voltage-gated sodium channels (VGSC), is derived from Cone snail venom and</p>Fórmula:C106H172N46O30S6Pureza:98%Forma y color:SolidPeso molecular:2763.18δ-Theraphotoxin-Hm1b
δ-Theraphotoxin-Hm1b, a 42-amino acid peptide derived from the Togo starburst tarantula (Heteroscodra maculata) venom, selectively inhibits the inactivation ofFórmula:C169H241N45O50S6Pureza:98%Forma y color:SolidPeso molecular:3895.38Alexamorelin Met 1
Alexamorelin Met 1, a heptapeptide, inhibits GH secretagogue binding.Fórmula:NAPureza:98%Forma y color:SolidPeso molecular:622.68F-Chemotactic peptide-fluorescein
CAS:F-Chemotactic peptide-fluorescein is a fluorescent label.Fórmula:C64H76N8O14SPureza:98%Forma y color:SolidPeso molecular:1213.41µ-Conotoxin BuIIIC
CAS:μ-Conotoxin BuIIIC (Mu-Conotoxin BuIIIC) effectively inhibits the NaV1.4 sodium channel [1].Fórmula:C116H189N49O34S6Pureza:98%Forma y color:SolidPeso molecular:3006.44Phlo1a
Phlo1a (μ-TrTx-Phlo1a), a 35-amino acid peptide toxin, demonstrates a weak inhibitory effect on Nav1.2 and Nav1.5 channels [1].Fórmula:C178H262N52O49S6Pureza:98%Forma y color:SolidPeso molecular:4106.69Angiotensin I, asn(1)-val(5)-gly(9)-
CAS:Angiotensin I, asn(1)-val(5)-gly(9)- is isolated from the plasma of American eel, Anquilla rostrata.Fórmula:C57H84N16O13Pureza:98%Forma y color:SolidPeso molecular:1201.38Pterinotoxin-1
Pterinotoxin-1 is a peptide toxin that functions as an inhibitor of sodium channels [1].Fórmula:C163H251N49O53S7Pureza:98%Forma y color:SolidPeso molecular:3969.49Boc-Gly-Gly-Phe-Gly-OH TFA(187794-49-6,free)
Boc-Gly-Gly-Phe-Gly-OH TFA is a self-assembly of N-protected and C-protected tetrapeptides and is a protease cleaved connector for antibody-drug binding (ADC).Fórmula:C22H29F3N4O9Pureza:98%Forma y color:SolidPeso molecular:550.48Angiogenin (108-122) TFA (112173-49-6 free base)
Angiogenin (108-122) TFA, a therapeutic peptide for various diseases, including cancer and heart conditions.Fórmula:C80H126F3N25O25Pureza:98%Forma y color:SolidPeso molecular:1895QL9
CAS:QL9 is derived from the enzyme 2-oxoglutarate dehydrogenase and belongs to the endogenous peptide repertoire of all H-2d APCs.Fórmula:C52H74N10O14Pureza:98%Forma y color:SolidPeso molecular:1063.21Ribosomal protein L3 peptide (202-222) amide
Ribosomal protein L3 peptide (202-222), sequence H2N-MSHRKYEA…RKR-amide, MW=2573.Fórmula:C114H182N42O25SPureza:98%Forma y color:SolidPeso molecular:2573BDS-II
BDS-II, a peptide toxin comprising 43 amino acids, selectively inhibits the Kv3.4 channel [1].Fórmula:C214H301N57O57S6Pureza:98%Forma y color:SolidPeso molecular:4776.425-CR110 [5-Carboxyrhodamine 110] *Single isomer*
CR110 reagents are more photostable and pH-independent than FITC/FAM, with optimal absorption at 488 nm.Fórmula:C21H15N2O5ClPureza:98%Forma y color:SolidPeso molecular:410.81M-TriDAP
CAS:M-TriDAP (N-Acetylmuramyl-L-Ala-γ-D-Glu-meso-diaminopimelic acid) is a bioactive peptide functioning as a NOD1/2 agonist.Fórmula:C26H43N5O15Pureza:98%Forma y color:SolidPeso molecular:665.64Neuronostatin-13 human acetate
Neuronostatin-13 human acetate is a 13-amino acid peptide hormone, which plays an important role in the regulation of hormonal and cardiac function.Fórmula:C66H114N20O18Pureza:98%Forma y color:SolidPeso molecular:1475.73Ref: TM-TP1827L
1mg192,00€5mg582,00€10mg874,00€25mg1.570,00€50mg2.355,00€100mg3.535,00€200mg5.319,00€Relaxin C-peptide
CAS:Relaxin C-peptide, as a synthetic 14-amino acid peptide found in human decidua & placenta, can represent a partial sequence of human relaxin connecting peptide.Fórmula:C75H118N20O24Pureza:98%Forma y color:SolidPeso molecular:1683.885Apelin-13 TFA (217082-58-1 free base)
Apelin-13 is an endogenous ligand of APJ receptor, and the EC 50 value of activated G protein coupled receptor is 0.37 nM.Fórmula:C71H112F3N23O18SPureza:98%Forma y color:SolidPeso molecular:1664.85Orexin B, human TFA (205640-91-1 free base)
<p>Orexin B, human (TFA) is an endogenous agonist at Orexin receptor with Kis of 420 and 36 nM for OX1 and OX2.</p>Fórmula:C123H212N44O35S·C2HF3O2Pureza:98%Forma y color:SolidPeso molecular:3013.36β-Amyloid(1-14),mouse,rat
<p>Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide. This peptide is amino acids 1 to 14 fragment of Beta-Amyloid peptide.</p>Fórmula:C69H95N21O24Pureza:98%Forma y color:SolidPeso molecular:1603.7Tetrapeptide-2
CAS:<p>Tetrapeptide-2 is an amino acid peptide.</p>Fórmula:C24H37N5O8Pureza:98%Forma y color:SolidPeso molecular:523.58LRRKtide TFA
LRRKtide, a peptide substrate for leucine-rich repeat kinase 2 (LRRK2)—an enzyme often mutated in Parkinson's disease patients—corresponds to amino acids 550-Fórmula:C83H147N31O22·XCF3COOHForma y color:SolidPeso molecular:1931.30FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro
CAS:FITC-Ahx-Gly-Arg-Gly-Asp-Ser-Pro, also known as FITC-linked GRGDSP, is a fluorescent peptide with integrin inhibitory properties.Fórmula:C49H59N11O16SPureza:98%Forma y color:SolidPeso molecular:1090.12Calcitonin, eel TFA (57014-02-5 free base)
Calcitonin,eel TFA is a thyroid hormone polypeptide that can regulate calcium homeostasis and is widely used in the study of postmenopausal osteoporosis.Fórmula:C148H242F3N43O49S2Pureza:98%Forma y color:SolidPeso molecular:3528.89RO27-3225 TFA (274682-89-2 free base)
RO27-3225 TFA: potent MC4R agonist (EC50: 1 nM), 30x more selective than MC3R, neuroprotective, anti-inflammatory.Fórmula:C41H53F3N12O8Pureza:98%Forma y color:SolidPeso molecular:898.93Jingzhaotoxin-II
Jingzhaotoxin-II, a neurotoxin composed of 32 amino acid residues featuring two acidic and two basic residues, selectively inhibits voltage-gated sodiumFórmula:C154H219N39O45S7Pureza:98%Forma y color:SolidPeso molecular:3561.08Calciseptin
CAS:Calciseptine, a neurotoxin isolated from the Black Mamba (Dendroaspis p.Fórmula:C299H468N90O87S10Pureza:98%Forma y color:SolidPeso molecular:7036.12ω-Hexatoxin-Hv1a
CAS:ω-Hexatoxin-Hv1a, a neurotoxin extracted from the venom of the spider Hadronyche versuta, inhibits voltage-gated calcium channels [1] [2].Fórmula:C162H247N49O61S6Pureza:98%Forma y color:SolidPeso molecular:4049.38
![[Glu1]-Fibrinopeptide B](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP1864.webp&w=3840&q=75)
![[Pro3]-GIP (Mouse) acetate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2020L.webp&w=3840&q=75)
![hemagglutinin precursor (114-122) amide [Influenza A virus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2232.webp&w=3840&q=75)
![vitamin D binding protein precrusor (208-218) [Homo sapiens]/[Oryctolagus cuniculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2190.webp&w=3840&q=75)
![type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2188.webp&w=3840&q=75)
![immunoglobulin light chain variable region fragment [Homo sapiens]/[Mus musculus]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2259.webp&w=3840&q=75)
![heparin cofactor II precursor fragment [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2255.webp&w=3840&q=75)
![HBcAg [Hepatitis B virus] (18-27)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2231.webp&w=3840&q=75)
![Cytochrome P450 CYP1B1 (190-198) [Homo sapiens]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2FTM%2Fthumb-webp%2FTP2238.webp&w=3840&q=75)
