Péptidos

Peptide H-EVGDWRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.</p>

Peptide H-TPVSDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Fmoc-ß-Ala-OH is a synthetic amino acid that is used in the synthesis of cyclic peptides. It has been shown to have receptor activity, such as the ability to bind to an erythrocyte membrane protein. Fmoc-ß-Ala-OH is also able to stimulate macrophage-like cells and polypeptide synthesis. Fmoc-ß-Ala-OH has been synthesized by chemical ligation, followed by purification on an agarose gel. This synthetic amino acid is used as a building block for affinity ligands, which are compounds that bind to specific receptors or other molecules with high specificity and affinity.</p>

<p>Peptide H-IPIEDGSGEVVLSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Ac-CRAELEKHGYKMETS is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GLPSSIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SDVVYTDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DYVSQFEGSALGK^^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-YGGFL^RRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-AVIQHFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-NTTCVNWNQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Bax-BH3 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.</p>

<p>K-252A is an antimicrobial agent that inhibits the growth of bacteria. It binds to the response element in the promoter region of genes and blocks gene transcription, thereby preventing protein synthesis. K-252A has been shown to inhibit the growth of bacteria that are resistant to many other antibiotics, including ampicillin, chloramphenicol, clindamycin, erythromycin, gentamicin and kanamycin. This drug also induces significant up-regulation of cyclic nucleotide phosphodiesterases (PDE) and cytosolic Ca2+ in vitro. K-252A has been shown to cause neuronal death in vitro by inhibiting axonal growth. K-252A also inhibits leukemia inhibitory factor (LIF) from binding to its receptor on mouse lymphocytes.</p>

<p>H-Ser-Phe-Leu-Leu-Arg-NH2 is a peptide that contains a cyclic backbone with aromatic residues. It has been shown to enhance the release of catecholamines from rat striatal slices and to inhibit platelet activation by thrombin receptor. It is also an agonist at the thrombin receptor and has been found to be effective in inhibiting the proteolytic activity of serine proteases such as thrombin, trypsin, and elastase. This peptide exhibits conformational properties that are favorable for interaction with protein receptors.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-ANELLINVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>BQ-123 is a cyclic peptide that blocks the endothelin-A receptor. It has been shown to be an effective treatment for pain and inflammation associated with osteoarthritis, rheumatoid arthritis, and other inflammatory conditions. BQ-123 binds to the endothelin-A receptor, which is located on the surface of cells in many tissues throughout the body. When bound, it inhibits intracellular calcium concentrations by reducing voltage-gated calcium channels and prevents the release of neurotransmitters. BQ-123 also has a stabilizing effect on hydrogen bonds due to its charged side chains. This property may account for its ability to form stable complexes with other proteins, inhibiting their function.<br>BQ-123 has been shown to have an active binding site on cyclic AMP response element binding protein (CREB) that inhibits CREB activity, thereby reducing protein synthesis. It also blocks cyclic GMP (cGMP)-dependent protein kin</p>

<p>Peptide H-TF^GSG^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

H-CSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-GNPESSFNDENLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YPIKPEAPGEDASPEEL^NRYYASL^RHYL^NLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ala-AMC is a fluorescent peptide that binds to the receptor AMPA and activates it. This product is used in research as a tool for studying protein interactions, cellular biology and pharmacology.

<p>Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.</p>

<p>Peptide Biot-SARAGETRFTDTRKDE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DLQVNSL^QTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LPASPETHL^DMLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Ac-Tyr-Val-Gly is a mitochondrial protein that regulates mitochondrial functions and is involved in the regulation of apoptosis. Ac-Tyr-Val-Gly interacts with nuclear DNA and regulates transcription, translation, and replication. Ac-Tyr-Val-Gly has been shown to be toxic to liver cells; however, it has been shown to have no effect on neuronal death or apoptosis pathway. These effects may be due to its ability to induce proteolytic activity in neurons and its ability to activate proapoptotic proteins such as Bax.</p>

Peptide H-DMQLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SIIVFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ATNATLDPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Cys(Pam)2-OH is a building block that can be used in the synthesis of lipopeptides. It is used in the research of vaccines and has been shown to target tumor cells.</p>

<p>H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.</p>

<p>Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.</p>

<p>Peptide H-FL^HVTYVPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-EAEDL^QVGQVELGGGPGAGSLQPLALEGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-PRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPRPR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

<p>Peptide H-VADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VYIHP^F-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VSVFVPPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TFA salt. Enfuviritide is a bicyclic heterocycle that is used in the treatment of HIV/AIDS. It binds to the HIV-1 envelope protein, preventing it from binding to CD4+ cells and infecting them. Enfuviritide has been shown to be effective at increasing the levels of active antiretroviral therapy and has shown significant cytotoxicity against HIV-1 and other infectious viruses. This drug also inhibits viral life by binding to the viral envelope protein gp120 and preventing it from binding to CD4+ cells. However, this drug may have long-term toxicity and may cause drug interactions with other drugs that are metabolized by cytochrome P450 enzymes. Enfuviritide has inhibitory properties against a wide range of antimicrobial agents including Gram-positive bacteria, Gram-negative bacteria, fungi, protozoa, and enveloped viruses.</p>

<p>UDP-β-L-Rhamnose is a pentose sugar that is used as a research tool and an activator. It has been shown to be an inhibitor of ion channels and protein interactions, as well as a ligand for certain receptors. This compound has high purity and can be used in the study of cell biology, pharmacology, and immunology.</p>

<p>Peptide H-YASESMSGI^P^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TFEERN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EVTVDTTLAGYHLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LLAEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FGGNPGGFGNQGGFGNSR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FQELESETLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Prolyl Endopeptidase is a polypeptide that belongs to the family of enzymes known as endopeptidases. It is involved in peptide degradation and has been shown to be inhibited by synthetic products. Prolyl Endopeptidase is structurally similar to other members of the serine protease family and has been shown to hydrolyze the polypeptide bond adjacent to proline residues.

<p>Peptide H-TENNDHINLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RPPGFSPF^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-GDSLAYGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TYFPHFDVSHGSAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RPFYSNAPQEIFIQQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ISAPNVDFNLEGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-YTPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-KALETLRRVGDGVQRNHETAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VHLTPE^EKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ATFNPAQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Z-Val-Lys-Met-MCA is a synthetic peptide that can act as an inhibitor or activator. Z-Val-Lys-Met-MCA binds to the receptor and inhibits the receptor from binding with its ligand, which prevents activation of the receptor. It also has been shown to activate other receptors, such as ion channels, by binding to them. This makes it an important research tool for understanding protein interactions.</p>

Peptide Ac-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Biot-QTSSPNTGKTSTISTT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-KDVLETFTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-LRRFSTAPF^AFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-HKLSEKLNPSVLRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VAAGAFQGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NVDLSTFYQNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EHSSLAFWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-CQHIMAILHYFEIVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Boc-p-Aminobenzoic Acid is an extracellular peptidase inhibitor that has been shown to be damaging to cells. It is a conjugate of p-aminobenzoic acid with the unusual amino acid Boc, which inhibits the activity of proteinases and peptidases. This drug is used for the treatment of emphysema, an autoimmune disease, and prostate carcinoma. It has also been shown to inhibit the growth of some tumor cells by blocking cell division and DNA synthesis. The enzyme carbonic anhydrase II (CAII) is responsible for the conversion of carbon dioxide into bicarbonate ions in tissues. Boc-p-Aminobenzoic Acid can inhibit CAII, which may lead to tissue damage or death.</p>

<p>Peptide H-LAVYQAGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALDLLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide aiC15-RIIDLLWRVRRPQKPKFVTVWVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VLGAFSDGLAHLDNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-GYSFTTTAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.<br>One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD</p>

Peptide LCBiot-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALFPGDSEIDQLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VYSTSVTGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-Phe-OH is a group P2, amide compound. It has been shown to exhibit anti-cancer activity and has been used in the synthesis of peptides. Boc-Phe-OH is an inhibitor of aminopeptidases and has been shown to inhibit the growth of herpes simplex virus. As a result, it is a useful tool for studying the biological function of these enzymes.</p>

<p>Peptide H-AKTDHGAEIVYKSPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FQTLLALHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-LL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Octreotide is a drug that belongs to the macrocycle class of polymers. It is used in the treatment of cancer, as well as for diseases such as diabetes mellitus and acromegaly. Octreotide has been shown to inhibit p-glycoprotein (P-gp) and other drug transporters, which leads to an increase in oral bioavailability. In addition, octreotide also inhibits cellular proliferation by interfering with intracellular signalling pathways and protein synthesis. This drug has been shown to have a wide range of biochemical properties and is being investigated as an investigational agent for the treatment of various cancers.</p>

Peptide H-GDLIAEVETDK^ATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LLGIETPLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-EVALDLSQHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GQVLVFLGQSEGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-NAINNGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-THLAPYSDELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-TITLEVESSDTIDNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-THPHFVIPYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YFIIQDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-VLELTSDNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ITQSNAILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-FLRGRAYGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Boc-Cys(Acm)-OH is a peptide that is used as a research tool in cell biology. It can be used to activate an antibody and is frequently used in studies of ion channels. Boc-Cys(Acm)-OH binds to the receptor, which leads to the activation of ligand binding, leading to pharmacological activity. The chemical formula for this compound is C24H38N6O7 with a molecular weight of 498.09 g/mol.</p>

<p>Peptide Ac-CKATQASQEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LSEAEEALYLIAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Amastatin is a synthetic product that inhibits peptidases. It is an inhibitor of the protease enzyme and can be used in the treatment of bladder infections caused by Chlamydia parvum. Amastatin has also been shown to inhibit Aminopeptidase, which is an enzyme that cleaves amino acids from proteins, thereby inhibiting protein synthesis. Amastatin has been shown to have an inhibitory effect on proteases in the striatal membranes of rats and may be useful in treating neurodegenerative disorders such as Parkinson's disease.</p>

<p>Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-VAGFNLLMTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Ac-SADTNKRKRDEGIQESPVC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ALLTSRLRFI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FEGDTLVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-WVDGTDYETGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-VLQWAKKGYYTMKSN-NTBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CHHHHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LANDAAQVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-NGFFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Aoa-KFERQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-LPDATPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SASL^HLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-R^PHFPQFSYSASGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VDTVDPPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLVVTDPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Enkephalins are a group of endogenous peptides that are the most potent natural analgesic and have been shown to relieve pain by inhibiting neurotransmitters. The (Met(O)5)-enkephalin analog is a structural analog of the enkephalin peptide with a sulfoxide linkage at position 5. This analog has been shown to inhibit acetylcholine release from intestinal ganglia, which may be related to its effects on postsynaptic potentials and glutamate release. This compound also absorbs in the small intestine, where it is taken into the blood stream and transported to the brain. The (Met(O)5)-enkephalin analog has been shown to reduce pain in Sprague-Dawley rats, as well as inhibit intestinal transit time and stimulate intestinal motility.</p>

<p>Peptide H-VLQSALAAIR^ -OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Boc-D-Trp-OH is a trisubstituted, enantiomerically pure, excitatory amino acid. It has been shown to stimulate the release of neurotransmitters in the central nervous system and to have potent antitumor activity. Boc-D-Trp-OH is an unsaturated ketone that can be used as a building block for peptide synthesis. The disulfide bond present in this molecule may be reduced by the addition of DTT or DTE. This compound has also been shown to have cardiac hypertrophy inhibiting effects, due to its ability to inhibit PDE5 enzyme activity.</p>

<p>Peptide Z-GFFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LL^EAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DYGAVNEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-ILGGHLDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VTEHDTLLY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ASQETFG-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QMVQQFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Fmoc-Pro-OH is a peptide that contains the Fmoc protecting group. It is used in the synthesis of peptides and has been shown to be effective against microbial infections with marine sponges. The synthesis of this compound can be carried out on an on-line automated peptide synthesizer. The Fmoc protecting group is removed by treatment with trifluoroacetic acid (TFA) in dichloromethane, which leaves the side chain unprotected. This compound has a high binding affinity for the receptor site of fibrinogen and can potentially inhibit the growth of bacteria that cause bacterial infection, such as Staphylococcus aureus and Pseudomonas aeruginosa.<br>Fmoc-Pro-OH can also be used to synthesize other functional groups such as sulfamoyl groups or acetonitrile groups, depending on the desired outcome.</p>

Peptide LCBiot-LPET-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-P^GLYYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-QVPSRPNRAP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VEIFYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CAEPQKSPW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>