Péptidos
Subcategorías de "Péptidos"
Se han encontrado 29608 productos de "Péptidos"
H-VGGTGMFTVR^-OH
Peptide H-VGGTGMFTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.MAGE-3 (191-205)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolHistone H3 peptide (non-modified A.A. 1-44), biotin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-GNQWVGYDDQESVK^-OH
Peptide H-GNQWVGYDDQESVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AC-SDKP TRIFLUOROACETATE
CAS:AC-SDKP TRIFLUOROACETATE is a synthetic peptide, which is a derivative of the naturally occurring tetrapeptide L-seryl-L-aspartyl-L-lysyl-L-proline. This product is typically sourced through chemical synthesis, enabling precise structural and functional consistency.The mode of action of AC-SDKP involves its role as an endogenous antifibrotic agent. It functions by inhibiting the proliferation and differentiation of fibroblasts, thereby reducing collagen deposition. This action largely contributes to its ability to prevent fibrosis in various tissues. Additionally, AC-SDKP is known for its cardiovascular protective effects, partially through its interaction with the renin-angiotensin system and its ability to reduce inflammation.AC-SDKP TRIFLUOROACETATE is primarily used in scientific research focused on fibrotic diseases and cardiovascular disorders. It is a valuable tool for studying pathological mechanisms underlying fibrosis and developing potential therapeutic strategies. Its applications extend to investigating myocardial fibrosis, renal fibrosis, and idiopathic pulmonary fibrosis, among others, providing insights into treatment approaches that aim to mitigate disease progression.
Fórmula:C20H33N5O9•C2HF3O2Peso molecular:601.53 g/molH-SIAFSR^-OH
Peptide H-SIAFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ERPPPVPNPDYEPIR^-OH
Peptide H-ERPPPVPNPDYEPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-LFGGY-OH
Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SOR-C13
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Fórmula:C72H116N20O19Peso molecular:1,565.81 g/molAoa-THRPPMWSPVWP-NH2
Peptide Aoa-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Biot-KKKKEEIYFFF-OH
Peptide Biot-KKKKEEIYFFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGEVIVTK^-OH
Peptide H-VGEVIVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YTIAALLSPYSYSTTAVVTNPK^E-OH
Peptide H-YTIAALLSPYSYSTTAVVTNPK^E-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLYSFPEP^EA-OH
Peptide H-SLYSFPEP^EA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GYSIFSYATK^-OH
Peptide H-GYSIFSYATK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Trp-Phe-OH
CAS:H-Trp-Phe-OH is a chromatographic, ligand, and mass spectrometric compound that has a red shift in its fluorescence spectrum. It has been shown to have anti-cancer properties by blocking the cell cycle at the G2/M phase. The red shift of the fluorescence spectrum is due to the presence of two isomeric forms that have different optical properties. H-Trp-Phe-OH has been analysed for its effects on cancer cells and was found to inhibit growth and induce apoptosis in mononuclear leukemia cells.
Fórmula:C20H21N3O3Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:351.4 g/molLys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C41H75N11O11Peso molecular:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGYLQIGANTQAAQK^-OH
Peptide H-EGYLQIGANTQAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pMOG (44 - 54)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C61H94N20O15Peso molecular:1,347.6 g/molZ-Val-Val-OH trifluoroacetic acid
CAS:Z-Val-Val-OH trifluoroacetic acid is a gelator that belongs to the group of amides. It has long chain and intermolecular hydrogen bonding and can be used in the treatment of bacterial infections. Z-Val-Val-OH trifluoroacetic acid has been shown to have thermodynamic parameters for liquids that are more favorable than those for gels, which may account for its ability to form a gel at room temperature. This compound is not electron-micrographable in the solid state but can be tracked by electron microscopy when in solution.Fórmula:C18H26N2O5•C2HF3O2Pureza:Min. 95%Forma y color:PowderPeso molecular:464.43 g/molHBV HBsAg 190-197 (H-2 Kb)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-ITPSYVAFTPEGER^-OH
Peptide H-ITPSYVAFTPEGER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Thr(tBu)-Thr(Psi(Me,Me)pro)-OH
CAS:Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is a versatile building block that can be used as a starting material for the synthesis of a wide range of compounds. It is often used as an intermediate in organic chemistry reactions and can be converted to a variety of other compounds with different functional groups. This compound has been shown to be useful in the production of pharmaceuticals and research chemicals. Fmoc-Thr(tBu)-Thr(Psi(Me, Me)pro)-OH is also important for generating high-quality chemical products, such as speciality chemicals and reagents that are difficult to synthesize. The CAS number for this compound is 1676104-73-6.Fórmula:C30H38N2O7Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:538.63 g/mol(Tyr0)-Prepro-Atrial Natriuretic Factor (104-123) (human) H-Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-Leu-Thr- Ala-Pro-Arg-OH
CAS:(Tyr0)-Prepro-Atrial Natriuretic Factor (104-123) (human) H-Tyr-Ser-Ser-Asp-Arg-Ser-Ala-Leu-Leu-Lys-Ser-Lys-Leu-Arg-Ala-Leu-(OH)) is a fine chemical that is used as a building block in research and as a reagent. It has been shown to be an intermediate in the synthesis of various complex organic compounds, including pharmaceuticals. This compound also has many uses in organic synthesis, including as a building block for peptides and proteins. The CAS number for this compound is 309245-24 7.Fórmula:C103H180N32O30Pureza:Min. 95%Forma y color:White PowderPeso molecular:2,346.73 g/mol3-O-Hexadecyl-sn-glycerol
CAS:3-O-Hexadecyl-sn glycerol (3OHG) is a neutral, high molecular weight glycol ether that is used for the preparation of zirconium oxide. 3OHG has been shown to be a substrate for carbohydrate chemistry and as an inhibitor of enzymes, such as hexokinase and phosphoglycerate kinase. 3OHG has minimal toxicity when administered orally to rats and does not cause any hemolysis in human erythrocytes. This compound is also a monoclonal antibody that binds to the surface glycoprotein on the HL-60 cell line and inhibits its growth. 3OHG is not cytotoxic at concentrations up to 10 mM in cultured cells, but it can induce Ca2+ release from the cytosol in HL-60 cells with minimal toxicity. The structure of 3OHG appears closely related to benzalkonium chloride (BAC).Fórmula:C19H40O3Pureza:Min. 95%Peso molecular:316.52 g/molH-R^PPGFSPFR-OH
Peptide H-R^PPGFSPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-EEQYNSTYR-OH
Peptide Ac-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH is a reagent used in the synthesis of complex compounds. It is also a useful scaffold for the synthesis of speciality chemicals and versatile building blocks. This compound is an intermediate that can be used in the preparation of fine chemicals and pharmaceuticals. Fmoc-Cys((S)-2,3-di(palmitoyloxy)-propyl)-OH has a CAS number of 139573-78-7 and can be purchased as a high quality chemical.Fórmula:C53H83NO8SPureza:Min. 95 Area-%Forma y color:Slightly Yellow PowderPeso molecular:894.29 g/molH-LWEGSTSR^-OH
Peptide H-LWEGSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WAIIEEFTK^-OH
Peptide H-WAIIEEFTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQFLLTGDTQGR^-OH
Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLLLGAGESGK^-OH
Peptide H-LLLLGAGESGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-2Kd Mouse MAGE-A3 SYVKVLHHM
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolBombinin-Like Peptide (BLP-1)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFórmula:C115H194N34O33Peso molecular:2,581.04 g/mol(Des-Glu22)-Amyloid β-Protein (1-40) trifluoroacetate
CAS:The Aβ E22delta mutant (Osaka mutation) is more resistant to degradation by two major Aβ-degrading enzymes, neprilysin and insulin-degrading enzyme. It also shows unusual aggregation properties with enhanced oligomerization but no fibrilization.
Fórmula:C189H288N52O55SPureza:Min. 95 Area-%Forma y color:PowderPeso molecular:4,200.69 g/molHippuryl-Arg-OH
CAS:Hippuryl-arginine is a peptide hormone that is released by the hypothalamus and stimulates the pituitary gland to release other hormones. It has been shown to increase chemotactic activity in human serum, although it has no effect on carboxypeptidase or soybean trypsin activity. Hippuryl-arginine binds with basic proteins, such as albumin and immunoglobulins, and increases their enzymatic activities. This hormone also inhibits enzymes such as carboxy terminal phosphatases and aminopeptidases that are responsible for degrading amino acids. Activation of hippuryl-arginine may be due to its carboxy terminal group, which is susceptible to cleavage by proteolytic enzymes.Fórmula:C15H21N5O4Pureza:(%) Min. 97%Forma y color:PowderPeso molecular:335.36 g/molHLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolPeso molecular:1,093.3 g/molH-Arg-Glu(Edans)-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dabcyl)-Arg-OH
H-Arg-Glu(Edans)-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dabcyl)-Arg-OH is a peptide that is a substrate for the enzyme beta secretase. It has been observed to inhibit γ secretase activity in cell culture. This product can be used as an enzyme substrate or biochemicals, such as memapsin.Fórmula:C91H129N25O25SPureza:Min. 95%Peso molecular:2,005.26 g/molH-GAVDGGLSIPHSTK^-OH
Peptide H-GAVDGGLSIPHSTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EGVVHGVATVAEK^-OH
Peptide H-EGVVHGVATVAEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSLAVLGK^-OH
Peptide H-TSLAVLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AIPELTK^-OH
Peptide H-AIPELTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-GTTPSPVPTTSTTSAP-NH2
Peptide Biot-GTTPSPVPTTSTTSAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
fCBD -LL37 Conversion of 1-2mgs from TFA to HCL.
Peptide fCBD -LL37 Conversion of 1-2mgs from TFA to HCL. is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CSCSSLMDKECVY^FCHLDIIW^VNTPEHVVPYGL^GSPRS-OH
H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
Cyclin-D2 Human Recombinant
Please enquire for more information about Cyclin-D2 Human Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this pagePureza:>85% By Sds-Page.H-Tyr-Val-Met-Gly-His-Phe-Arg-D-Trp-Asp-Arg-Phe-Gly-OH
H-Tyr-Val-Met-Gly-His-Phe-Arg-D-Trp-Asp-Arg-Phe-Gly-OH is a peptide that has been shown to bind to the melanocortin receptor. It is a selective agonist that binds to the melanocortin 2 receptor, but not the melanocortin 1 receptor. This peptide has no effect on body weight in mice, but it does cause an increase in food intake and fat mass. H-Tyr-Val-Met gly His Phe Arg D Trp Asp Arg Phe Gly OH also has been shown to be an effective analgesic for chronic pain in rats.Fórmula:C74H99N21O16SPureza:Min. 95%Peso molecular:1,570.81 g/mol
